Os02t0327000-01

Locus

Os02g0327000

Description

C2 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGAP1, GAP1

Oryzabase Gene Name Synonym(s)

GTPase-activating protein 1

Transcript Evidence

AK073631 (DDBJ, Best hit)

Protein Evidence

B4FFK7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

C2 calcium-dependent membrane targeting (IPR000008)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

C2 membrane targeting protein (IPR018029)

Full-length cDNA

J033052D22 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0327000-01)

RiceXPro (AK073631)

Others

Oryzabase (19660)

KEGG (Os02t0327000-01)

Transcript

1059 bp

>Os02t0327000-01 C2 domain containing protein.
GACTTGACCAGAGACGAGCAGCAAGGGGGCAGTTGGATTGGATTAGAGGGTGCTTTTATA
TAGAGGAGCACGAGGAGGAGGAGGAGGAGGGCCATCAAGCATATCCATCTCCGATTCACA
GATTCTTTCTGGAGATCCATCATCCAGCGAGAGCGAGAGCGAGAGGGAGAGGAAGAGGGA
AAGCCGCCACCGCCATGTTGGGGCATCTGGTTGGGCTGGTGAAGGTGCGGGTGGTGAGGG
GCGTCAACCTCGCCGTCCGCGACCTCCGCTCCAGCGACCCCTACGTCATCGTCCGCATGG
GCAAGCAGAAGTTGAAGACACGAGTCATAAAAAAGACTACCAATCCGGAGTGGAACGATG
AACTCACCCTCTCGATTGAAGATCCAGCAGTTCCTGTTAGACTGGAAGTGTATGACAAAG
ACACATTCATCGATGATGCAATGGGCAATGCGGAGCTGGACATCCGCCCATTGGTGGAGG
TTGTCAAGATGAAGATTGAGGGTGTTGCTGACAACACGGTTGTGAAGAAAGTGGTACCCA
ATAGACAGAACTGCCTAGCTGAAGAGAGCACGATATATATCTCTGAGGGGAAGGTGAAGC
AAGACGTGGTTCTCAGACTAAGGGATGTGGAATGCGGGGAAATTGAGCTCCAGCTTCAGT
GGGTCGACATCCCAGGTTCTAAGGGTGTATGAACTCTGTACTCTGCCTATTGCTTACAGT
CTTGCATAGCTCGCAAGTCCAACTCTAAGTTTATCAGTGGACAATCAAATAAGCAACAGC
TTATATTGATGAGATTCTTTTACTGTCCTTGAGGAGGCAGATACCTCCCAGTGCCTCCTC
AATGGCTGTAAAATCATTCTTATGTTGACACAGCAAGTGTCTCGAAGATCCCCCACTAGG
TGTTTGGGCAGAGCAAAGTTGTACAATATGTCTGCAAAGTATAGTTTGGTGTTACCCTGT
CTGTAGAAAAATAATCAGTGGCAGGGGTTGTAACTATTGAAACTTTGTCTGTCTTTCTTC
TTGTACGCCAAAGACCAATGCTATCTGCGATTAATCTTC

CDS

498 bp

>Os02t0327000-01 C2 domain containing protein.
ATGTTGGGGCATCTGGTTGGGCTGGTGAAGGTGCGGGTGGTGAGGGGCGTCAACCTCGCC
GTCCGCGACCTCCGCTCCAGCGACCCCTACGTCATCGTCCGCATGGGCAAGCAGAAGTTG
AAGACACGAGTCATAAAAAAGACTACCAATCCGGAGTGGAACGATGAACTCACCCTCTCG
ATTGAAGATCCAGCAGTTCCTGTTAGACTGGAAGTGTATGACAAAGACACATTCATCGAT
GATGCAATGGGCAATGCGGAGCTGGACATCCGCCCATTGGTGGAGGTTGTCAAGATGAAG
ATTGAGGGTGTTGCTGACAACACGGTTGTGAAGAAAGTGGTACCCAATAGACAGAACTGC
CTAGCTGAAGAGAGCACGATATATATCTCTGAGGGGAAGGTGAAGCAAGACGTGGTTCTC
AGACTAAGGGATGTGGAATGCGGGGAAATTGAGCTCCAGCTTCAGTGGGTCGACATCCCA
GGTTCTAAGGGTGTATGA

Protein

166 aa

>Os02t0327000-01 C2 domain containing protein.
MLGHLVGLVKVRVVRGVNLAVRDLRSSDPYVIVRMGKQKLKTRVIKKTTNPEWNDELTLS
IEDPAVPVRLEVYDKDTFIDDAMGNAELDIRPLVEVVKMKIEGVADNTVVKKVVPNRQNC
LAEESTIYISEGKVKQDVVLRLRDVECGEIELQLQWVDIPGSKGV*

5'UTR

chr02:13173784..13173977 (+ strand) : 194 bp

CDS

chr02:13173978..13174091 (+ strand) : 114 bp

chr02:13174399..13174494 (+ strand) : 96 bp

chr02:13175528..13175815 (+ strand) : 288 bp

3'UTR

chr02:13175816..13176182 (+ strand) : 367 bp

FASTA

>Os02t0327000-01 class=Sequence position=chr02:13173784..13176182 (+ strand)
GACTTGACCA GAGACGAGCA GCAAGGGGGC AGTTGGATTG GATTAGAGGG TGCTTTTATA TAGAGGAGCA CGAGGAGGAG
GAGGAGGAGG GCCATCAAGC ATATCCATCT CCGATTCACA GATTCTTTCT GGAGATCCAT CATCCAGCGA GAGCGAGAGC
GAGAGGGAGA GGAAGAGGGA AAGCCGCCAC CGCCATGTTG GGGCATCTGG TTGGGCTGGT GAAGGTGCGG GTGGTGAGGG
GCGTCAACCT CGCCGTCCGC GACCTCCGCT CCAGCGACCC CTACGTCATC GTCCGCATGG GCAAGCAGGT CGGGACTTGC
ACCCGCTCTT TCTTCTTCTT CCCCTTTTCA CCGCTGTGTT GTGTTATTTT ATTTTGGTCC AGAGGTTTAT CGTGTTCAGG
CGATGTCTGA TTTGTGAATT TCATTTTTTT TATTCTTTTT GGCTGGAAAG AGGTGAACAA AAAGGGATCT TGTTGAATTT
CAATCTCTCT CTCTCTCTCT CTCGCCATTT TTCTTTCTAC CCTGGTTAAT TGTTCATGTA TTGTGTACCT TTTGCTGCTT
GTTTTTTTTT ATTGTTCGCC TGCTAACTAT GATGATATTT GCTAACATTT CGCAGAAGTT GAAGACACGA GTCATAAAAA
AGACTACCAA TCCGGAGTGG AACGATGAAC TCACCCTCTC GATTGAAGAT CCAGCAGTTC CTGTTAGACT GGTATATATC
CCCTTTCCTT TTCACTTCGC CCTTTTCTTT CTTGTTGTGC TACACAAACA AATAAAAATG AAAACTTCAC GAGTATTTTC
TTACTATGCC ATTTCTCGGG AAACAATGGA TAATAAACAT TTTGGTATTT AAAGTGGATT GTCAGTTGGA TTGTTATACT
GATTGGCAAG CGTAATCAAC TAGACGGCCA CATCACTTCA AATGCTAAAA CCAAGTAGGA GGAGTTGTAA TTTTTATAGC
TAGCTCTCTA TCAGACGCCA TTCTAATCGG ACTAAATTAT CTGTTCTGCA TACAAGCACC AAATCTTGTC TAAGTAATAT
TCTTACTTCT TATTTGCTTG AGTAACTGTT AAGCAAGGGA CTAAATCTGA TGTTTTCTTG TTGGTGAATT GAAATATAGC
AAACATTTAT TTATATATAT CTTCTTGAGT TGAGTATACT CCTACCTGCC TCCATGGCTG AATTTAGAAT ATTAATTTTC
TGAATAAAGA CTAATTAGCA CTCCATCAGA GTAGTACAAG GCTCATTAAT ATTTACCAGA ACAAGTAGAT ACTAAAGAAT
ATTCTGATCT GTTGGAGATA TAGTGGCTGG TCAGAGGCCG CTAAGTGGCT TTACCAATAC CATGGTCAGG CTAACGCCGT
CCTCTCTAAg gactgttttg gattgctact gaaatgtgcc ctaccaatat tttggtagct tgaataggag aatattagta
tctataataa ttcatttaat ttgaagccaa ctatttgata atatctatac taaatttggt agcaatctag aatattctcc
actatagtat cacaatttag ctctacgttt ggtagcaaac caaacttggc caatataaac ttaccctacc aaattattgg
tagtgccaaa acttgtctag attttggtgc taccaaagaa ttggtaggat agtgaaccaa ataggcccAA ATAATATGAT
TTGATAAATA ATTCTTTGAC CAAAGAGTGG TTCTGATATA TAGTTATATT TTGGTCCTGA ACAGGAAGTG TATGACAAAG
ACACATTCAT CGATGATGCA ATGGGCAATG CGGAGCTGGA CATCCGCCCA TTGGTGGAGG TTGTCAAGAT GAAGATTGAG
GGTGTTGCTG ACAACACGGT TGTGAAGAAA GTGGTACCCA ATAGACAGAA CTGCCTAGCT GAAGAGAGCA CGATATATAT
CTCTGAGGGG AAGGTGAAGC AAGACGTGGT TCTCAGACTA AGGGATGTGG AATGCGGGGA AATTGAGCTC CAGCTTCAGT
GGGTCGACAT CCCAGGTTCT AAGGGTGTAT GAACTCTGTA CTCTGCCTAT TGCTTACAGT CTTGCATAGC TCGCAAGTCC
AACTCTAAGT TTATCAGTGG ACAATCAAAT AAGCAACAGC TTATATTGAT GAGATTCTTT TACTGTCCTT GAGGAGGCAG
ATACCTCCCA GTGCCTCCTC AATGGCTGTA AAATCATTCT TATGTTGACA CAGCAAGTGT CTCGAAGATC CCCCACTAGG
TGTTTGGGCA GAGCAAAGTT GTACAATATG TCTGCAAAGT ATAGTTTGGT GTTACCCTGT CTGTAGAAAA ATAATCAGTG
GCAGGGGTTG TAACTATTGA AACTTTGTCT GTCTTTCTTC TTGTACGCCA AAGACCAATG CTATCTGCGA TTAATCTTC

Locus: Os02g0327000

Loading...

Locus: Os02g0327000

Loading...