Os02t0327000-02

Locus

Os02g0327000

Description

C2 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGAP1, GAP1

Oryzabase Gene Name Synonym(s)

GTPase-activating protein 1

Transcript Evidence

AK104165 (DDBJ, Best hit)

Protein Evidence

B4FFK7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

C2 calcium-dependent membrane targeting (IPR000008)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

C2 membrane targeting protein (IPR018029)

Full-length cDNA

006-212-C07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0327000-02)

RiceXPro (AK104165)

Others

Oryzabase (19660)

KEGG (Os02t0327000-02)

Transcript

966 bp

>Os02t0327000-02 C2 domain containing protein.
GAGGGCCATCAAGCATATCCATCTCCGATTCACAGATTCTTTCTGGAGATCCATCATCCA
GCGAGAGCGAGAGCGAGAGGGAGAGGAAGAGGGAAAGCCGCCACCGCCATGTTGGGGCAT
CTGGTTGGGCTGGTGAAGGTGCGGGTGGTGAGGGGCGTCAACCTCGCCGTCCGCGACCTC
CGCTCCAGCGACCCCTACGTCATCGTCCGCATGGGCAAGCAGAAGTTGAAGACACGAGTC
ATAAAAAAGACTACCAATCCGGAGTGGAACGATGAACTCACCCTCTCGATTGAAGATCCA
GCAGTTCCTGTTAGACTGGAAGTGTATGACAAAGACACATTCATCGATGATGCAATGGGC
AATGCGGAGCTGGACATCCGCCCATTGGTGGAGGTTGTCAAGATGAAGATTGAGGGTGTT
GCTGACAACACGGTTGTGAAGAAAGTGGTACCCAATAGACAGAACTGCCTAGCTGAAGAG
AGCACGATATATATCTCTGAGGGGAAGGTGAAGCAAGACGTGGTTCTCAGACTAAGGGAT
GTGGAATGCGGGGAAATTGAGCTCCAGCTTCAGTGGGTCGACATCCCAGGTTCTAAGGGT
GTATGAACTCTGTACTCTGCCTATTGCTTACAGTCTTGCATAGCTCGCAAGTCCAACTCT
AAGTTTATCAGTGGACAATCAAATAAGCAACAGCTTATATTGATGAGATTCTTTTACTGT
CCTTGAGGAGGCAGATACCTCCCAGTGCCTCCTCAATGGCTGTAAAATCATTCTTATGTT
GACACAGCAAGTGTCTCGAAGATCCCCCACTAGGTGTTTGGGCAGAGCAAAGTTGTACAA
TATGTCTGCAAAGTATAGTTTGGTGTTACCCTGTCTGTAGAAAAATAATCAGTGGCAGGG
GTTGTAACTATTGAAACTTTGTCTGTCTTTCTTCTTGTACGCCAAAGACCAATGCTATCT
GCGATT

CDS

498 bp

>Os02t0327000-02 C2 domain containing protein.
ATGTTGGGGCATCTGGTTGGGCTGGTGAAGGTGCGGGTGGTGAGGGGCGTCAACCTCGCC
GTCCGCGACCTCCGCTCCAGCGACCCCTACGTCATCGTCCGCATGGGCAAGCAGAAGTTG
AAGACACGAGTCATAAAAAAGACTACCAATCCGGAGTGGAACGATGAACTCACCCTCTCG
ATTGAAGATCCAGCAGTTCCTGTTAGACTGGAAGTGTATGACAAAGACACATTCATCGAT
GATGCAATGGGCAATGCGGAGCTGGACATCCGCCCATTGGTGGAGGTTGTCAAGATGAAG
ATTGAGGGTGTTGCTGACAACACGGTTGTGAAGAAAGTGGTACCCAATAGACAGAACTGC
CTAGCTGAAGAGAGCACGATATATATCTCTGAGGGGAAGGTGAAGCAAGACGTGGTTCTC
AGACTAAGGGATGTGGAATGCGGGGAAATTGAGCTCCAGCTTCAGTGGGTCGACATCCCA
GGTTCTAAGGGTGTATGA

Protein

166 aa

>Os02t0327000-02 C2 domain containing protein.
MLGHLVGLVKVRVVRGVNLAVRDLRSSDPYVIVRMGKQKLKTRVIKKTTNPEWNDELTLS
IEDPAVPVRLEVYDKDTFIDDAMGNAELDIRPLVEVVKMKIEGVADNTVVKKVVPNRQNC
LAEESTIYISEGKVKQDVVLRLRDVECGEIELQLQWVDIPGSKGV*

5'UTR

chr02:13173870..13173977 (+ strand) : 108 bp

CDS

chr02:13173978..13174091 (+ strand) : 114 bp

chr02:13174399..13174494 (+ strand) : 96 bp

chr02:13175528..13175815 (+ strand) : 288 bp

3'UTR

chr02:13175816..13176175 (+ strand) : 360 bp

FASTA

>Os02t0327000-02 class=Sequence position=chr02:13173870..13176175 (+ strand)
GAGGGCCATC AAGCATATCC ATCTCCGATT CACAGATTCT TTCTGGAGAT CCATCATCCA GCGAGAGCGA GAGCGAGAGG
GAGAGGAAGA GGGAAAGCCG CCACCGCCAT GTTGGGGCAT CTGGTTGGGC TGGTGAAGGT GCGGGTGGTG AGGGGCGTCA
ACCTCGCCGT CCGCGACCTC CGCTCCAGCG ACCCCTACGT CATCGTCCGC ATGGGCAAGC AGGTCGGGAC TTGCACCCGC
TCTTTCTTCT TCTTCCCCTT TTCACCGCTG TGTTGTGTTA TTTTATTTTG GTCCAGAGGT TTATCGTGTT CAGGCGATGT
CTGATTTGTG AATTTCATTT TTTTTATTCT TTTTGGCTGG AAAGAGGTGA ACAAAAAGGG ATCTTGTTGA ATTTCAATCT
CTCTCTCTCT CTCTCTCGCC ATTTTTCTTT CTACCCTGGT TAATTGTTCA TGTATTGTGT ACCTTTTGCT GCTTGTTTTT
TTTTATTGTT CGCCTGCTAA CTATGATGAT ATTTGCTAAC ATTTCGCAGA AGTTGAAGAC ACGAGTCATA AAAAAGACTA
CCAATCCGGA GTGGAACGAT GAACTCACCC TCTCGATTGA AGATCCAGCA GTTCCTGTTA GACTGGTATA TATCCCCTTT
CCTTTTCACT TCGCCCTTTT CTTTCTTGTT GTGCTACACA AACAAATAAA AATGAAAACT TCACGAGTAT TTTCTTACTA
TGCCATTTCT CGGGAAACAA TGGATAATAA ACATTTTGGT ATTTAAAGTG GATTGTCAGT TGGATTGTTA TACTGATTGG
CAAGCGTAAT CAACTAGACG GCCACATCAC TTCAAATGCT AAAACCAAGT AGGAGGAGTT GTAATTTTTA TAGCTAGCTC
TCTATCAGAC GCCATTCTAA TCGGACTAAA TTATCTGTTC TGCATACAAG CACCAAATCT TGTCTAAGTA ATATTCTTAC
TTCTTATTTG CTTGAGTAAC TGTTAAGCAA GGGACTAAAT CTGATGTTTT CTTGTTGGTG AATTGAAATA TAGCAAACAT
TTATTTATAT ATATCTTCTT GAGTTGAGTA TACTCCTACC TGCCTCCATG GCTGAATTTA GAATATTAAT TTTCTGAATA
AAGACTAATT AGCACTCCAT CAGAGTAGTA CAAGGCTCAT TAATATTTAC CAGAACAAGT AGATACTAAA GAATATTCTG
ATCTGTTGGA GATATAGTGG CTGGTCAGAG GCCGCTAAGT GGCTTTACCA ATACCATGGT CAGGCTAACG CCGTCCTCTC
TAAggactgt tttggattgc tactgaaatg tgccctacca atattttggt agcttgaata ggagaatatt agtatctata
ataattcatt taatttgaag ccaactattt gataatatct atactaaatt tggtagcaat ctagaatatt ctccactata
gtatcacaat ttagctctac gtttggtagc aaaccaaact tggccaatat aaacttaccc taccaaatta ttggtagtgc
caaaacttgt ctagattttg gtgctaccaa agaattggta ggatagtgaa ccaaataggc ccAAATAATA TGATTTGATA
AATAATTCTT TGACCAAAGA GTGGTTCTGA TATATAGTTA TATTTTGGTC CTGAACAGGA AGTGTATGAC AAAGACACAT
TCATCGATGA TGCAATGGGC AATGCGGAGC TGGACATCCG CCCATTGGTG GAGGTTGTCA AGATGAAGAT TGAGGGTGTT
GCTGACAACA CGGTTGTGAA GAAAGTGGTA CCCAATAGAC AGAACTGCCT AGCTGAAGAG AGCACGATAT ATATCTCTGA
GGGGAAGGTG AAGCAAGACG TGGTTCTCAG ACTAAGGGAT GTGGAATGCG GGGAAATTGA GCTCCAGCTT CAGTGGGTCG
ACATCCCAGG TTCTAAGGGT GTATGAACTC TGTACTCTGC CTATTGCTTA CAGTCTTGCA TAGCTCGCAA GTCCAACTCT
AAGTTTATCA GTGGACAATC AAATAAGCAA CAGCTTATAT TGATGAGATT CTTTTACTGT CCTTGAGGAG GCAGATACCT
CCCAGTGCCT CCTCAATGGC TGTAAAATCA TTCTTATGTT GACACAGCAA GTGTCTCGAA GATCCCCCAC TAGGTGTTTG
GGCAGAGCAA AGTTGTACAA TATGTCTGCA AAGTATAGTT TGGTGTTACC CTGTCTGTAG AAAAATAATC AGTGGCAGGG
GTTGTAACTA TTGAAACTTT GTCTGTCTTT CTTCTTGTAC GCCAAAGACC AATGCTATCT GCGATT

Locus: Os02g0327000

Loading...

Locus: Os02g0327000

Loading...