Os02t0437200-01

Locus

Os02g0437200

Description

SNAP-34.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSNAP32, SNAP32

Oryzabase Gene Name Synonym(s)

Synaptosomal-associated protein 32, Synaptosome-associated protein of 32 kD

Transcript Evidence

AK065640 (DDBJ, Best hit)

Protein Evidence

Q5EEP3 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013038P06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0437200-01)

RiceXPro (AK065640)

Others

Oryzabase (14681)

KEGG (Os02t0437200-01)

Transcript

2190 bp

>Os02t0437200-01 SNAP-34.
GCCTACTACTAATTCTTCCGATCTGTCCGCAGAGGTACGCGCAGTTATTTCTGGACCTTC
TTGATAGTTAAGGTCGATCTTGGTTACTGGAATTTATAAGGAATCGGGATTTGGTGTGTG
TATTCTTGGCAAGTTGGCACGGGGGATGATCTTTGCCCAATTCAGTTTCATTTGTGCGCA
GAAACTTGCTTGCTGCGGAATCTGACCCAAGGAGTTTTCGAGATGAGCGGGAGGAGATCG
TTCTTCGCATCCAAGAAGCCGTCGCGGAGCAGCAACCCCTTCGACTCCGACTCCGACGAT
GGCGGGAGGGAGCAGAGACCGGCGAGGGCCTCCTCCGTGCCTCCTCCGGCCGACCAGCGG
GGCTCCCTCTTCGGCGGCGGGGATGGCTTCTCCGCCTCGTCGGCGGCGGCGAGGAGCCGG
TACAGGAACGACTTCCGCGACACCGGCGGCGTGGAGGCCCAGTCGGTGCAGGAGCTGGAG
GGCTACGCGGCGTACAAGGCGGAGGAGACCACTCAGCGGGTGCAGGGCTGCGTCCGCATC
GCCGAGGAGATGAGGGATACCGCGTCCAAGAGCCTCGTCACCATACACCAGCAGGGCCAG
CAGATCACGCGCACGCACATGATGACCCTCGACATCGACCAGGATCTCTCCAGGGTAACT
AACACAAACTAATAACTAATACTATGTGATTACTCAGAAGCCTGATTAATTCTGTTTGAT
CACATAGTGGCGTAACAAGTCCCCACCAAAATTGGCCTGTTTCCTTCAGAATTCCATCCT
TAATAAGTCCACGAAAACTGAAACAAACTTCGTGTCACACTTCAGAAATTAATTGCCAAC
TCCAAATTTACTGTATTATGTGGTAATAATGGCTAAAGGGAATTCTTCGCACCTTTTCAG
AGCGAGAAGCTGCTGGGTGATCTTGGGGGTATATTTTCCAAAAAGTGGAAGCCAAAAAAG
AATGGAGAAATCAGGGGGCCTATGCTAACTAGAGGTAATCTCCAACTCTAGTCTTGAAAT
AGTAGACTGCAACAACAGTTGCTGACAGGGAAAGCTTGTACTATGTGGTATCACTTATCA
GTTATGTTCTCTGTGTAACTAACTGGAAGGATGGAATTACTTGTATGCAGATGATTCCTT
CATTCGGAAGGGCAGCCATTTGGAACAAAGGCACAAACTGGGACTATCGGATCACCCACC
TCAATCGAATGCACGCCAATTCCATTCCGAGCCAACTTCAGCCCTCCAGAAAGTGGAGGT
AATGCGCTAAGACATATATGGTGATTGATTTGCTAAGTGTGTGTATTCTGATTATCTTGT
TGTGTTGCTCAGATGGAGAAGGCAAAGCAGGATGATGGCCTATCTGATCTAAGTAACATA
TTGACCGAGCTGAAAGGCATGGCGGTTGACATGGGCACTGAGATTGACAGGTGAATGCCA
CATTTTTCACTTTAGTTCATAAAAACTAATACACACTTGTTTTTTCTGAGATTGGCGTAT
TGTTATGTGGAATCCCTTTTTTGTGCTCTAATTCCAGCGTACTTTTATAGTTTGTACTAA
CTGCCAGTTTATGTTTAGTCCATTCTTTAAAAATTTTCACTTCTTCATGCTGAACGAACT
AAAAAGGAGTAAAAAGTTTGGCCAAAGTACCTTCAAATTCAAGCGGCAAATTACTTCCTA
ATATCTAATCTGGAACACTTTGCATAATTATATTTAAATCTGATGAGTATTGTTGCTTTA
ACAGTCCAACCAATAAAAATCATCATGTGATATGTCTTTTTGTCTGTTGATTGGATTCAG
ACAAACAAAGGCTTTGGGAGATTCAGAGAAGGACTACGACGAACTGAACTTCAGGATCAA
GGGAGCAAACACTCGGGCACGCCGTCTGCTTGGAAAATAAACTGCAGAATATAATCTCAT
CACAGGACAGGAGTCCTTCCATCCCTTTTACCCTTAGTCTTGTGGAGGATAATTAATTGT
TTTGTGGGCCATTGGTTCTGATGATTCTGTGCATCAGATTTTGATCAGTACGGTGAATGG
TTGGTCCTGGATATGTCAGGGTATAATGTATCTGTATATACTGCTATAGCCATTAGCCAG
TAATGCTTTGTGCCATTGTTTTGGAATTTGGATCGTTCGCAATTGTTTCAAATCGCGTTA
GCATCAATAAAATTAGCAATCTGCCAAGCC

CDS

450 bp

>Os02t0437200-01 SNAP-34.
ATGAGCGGGAGGAGATCGTTCTTCGCATCCAAGAAGCCGTCGCGGAGCAGCAACCCCTTC
GACTCCGACTCCGACGATGGCGGGAGGGAGCAGAGACCGGCGAGGGCCTCCTCCGTGCCT
CCTCCGGCCGACCAGCGGGGCTCCCTCTTCGGCGGCGGGGATGGCTTCTCCGCCTCGTCG
GCGGCGGCGAGGAGCCGGTACAGGAACGACTTCCGCGACACCGGCGGCGTGGAGGCCCAG
TCGGTGCAGGAGCTGGAGGGCTACGCGGCGTACAAGGCGGAGGAGACCACTCAGCGGGTG
CAGGGCTGCGTCCGCATCGCCGAGGAGATGAGGGATACCGCGTCCAAGAGCCTCGTCACC
ATACACCAGCAGGGCCAGCAGATCACGCGCACGCACATGATGACCCTCGACATCGACCAG
GATCTCTCCAGGGTAACTAACACAAACTAA

Protein

150 aa

>Os02t0437200-01 SNAP-34.
MSGRRSFFASKKPSRSSNPFDSDSDDGGREQRPARASSVPPPADQRGSLFGGGDGFSASS
AAARSRYRNDFRDTGGVEAQSVQELEGYAAYKAEETTQRVQGCVRIAEEMRDTASKSLVT
IHQQGQQITRTHMMTLDIDQDLSRVTNTN*

5'UTR

chr02:13951399..13951620 (- strand) : 222 bp

CDS

chr02:13950949..13951398 (- strand) : 450 bp

3'UTR

chr02:13949431..13950948 (- strand) : 1518 bp

FASTA

>Os02t0437200-01 class=Sequence position=chr02:13949431..13951620 (- strand)
GCCTACTACT AATTCTTCCG ATCTGTCCGC AGAGGTACGC GCAGTTATTT CTGGACCTTC TTGATAGTTA AGGTCGATCT
TGGTTACTGG AATTTATAAG GAATCGGGAT TTGGTGTGTG TATTCTTGGC AAGTTGGCAC GGGGGATGAT CTTTGCCCAA
TTCAGTTTCA TTTGTGCGCA GAAACTTGCT TGCTGCGGAA TCTGACCCAA GGAGTTTTCG AGATGAGCGG GAGGAGATCG
TTCTTCGCAT CCAAGAAGCC GTCGCGGAGC AGCAACCCCT TCGACTCCGA CTCCGACGAT GGCGGGAGGG AGCAGAGACC
GGCGAGGGCC TCCTCCGTGC CTCCTCCGGC CGACCAGCGG GGCTCCCTCT TCGGCGGCGG GGATGGCTTC TCCGCCTCGT
CGGCGGCGGC GAGGAGCCGG TACAGGAACG ACTTCCGCGA CACCGGCGGC GTGGAGGCCC AGTCGGTGCA GGAGCTGGAG
GGCTACGCGG CGTACAAGGC GGAGGAGACC ACTCAGCGGG TGCAGGGCTG CGTCCGCATC GCCGAGGAGA TGAGGGATAC
CGCGTCCAAG AGCCTCGTCA CCATACACCA GCAGGGCCAG CAGATCACGC GCACGCACAT GATGACCCTC GACATCGACC
AGGATCTCTC CAGGGTAACT AACACAAACT AATAACTAAT ACTATGTGAT TACTCAGAAG CCTGATTAAT TCTGTTTGAT
CACATAGTGG CGTAACAAGT CCCCACCAAA ATTGGCCTGT TTCCTTCAGA ATTCCATCCT TAATAAGTCC ACGAAAACTG
AAACAAACTT CGTGTCACAC TTCAGAAATT AATTGCCAAC TCCAAATTTA CTGTATTATG TGGTAATAAT GGCTAAAGGG
AATTCTTCGC ACCTTTTCAG AGCGAGAAGC TGCTGGGTGA TCTTGGGGGT ATATTTTCCA AAAAGTGGAA GCCAAAAAAG
AATGGAGAAA TCAGGGGGCC TATGCTAACT AGAGGTAATC TCCAACTCTA GTCTTGAAAT AGTAGACTGC AACAACAGTT
GCTGACAGGG AAAGCTTGTA CTATGTGGTA TCACTTATCA GTTATGTTCT CTGTGTAACT AACTGGAAGG ATGGAATTAC
TTGTATGCAG ATGATTCCTT CATTCGGAAG GGCAGCCATT TGGAACAAAG GCACAAACTG GGACTATCGG ATCACCCACC
TCAATCGAAT GCACGCCAAT TCCATTCCGA GCCAACTTCA GCCCTCCAGA AAGTGGAGGT AATGCGCTAA GACATATATG
GTGATTGATT TGCTAAGTGT GTGTATTCTG ATTATCTTGT TGTGTTGCTC AGATGGAGAA GGCAAAGCAG GATGATGGCC
TATCTGATCT AAGTAACATA TTGACCGAGC TGAAAGGCAT GGCGGTTGAC ATGGGCACTG AGATTGACAG GTGAATGCCA
CATTTTTCAC TTTAGTTCAT AAAAACTAAT ACACACTTGT TTTTTCTGAG ATTGGCGTAT TGTTATGTGG AATCCCTTTT
TTGTGCTCTA ATTCCAGCGT ACTTTTATAG TTTGTACTAA CTGCCAGTTT ATGTTTAGTC CATTCTTTAA AAATTTTCAC
TTCTTCATGC TGAACGAACT AAAAAGGAGT AAAAAGTTTG GCCAAAGTAC CTTCAAATTC AAGCGGCAAA TTACTTCCTA
ATATCTAATC TGGAACACTT TGCATAATTA TATTTAAATC TGATGAGTAT TGTTGCTTTA ACAGTCCAAC CAATAAAAAT
CATCATGTGA TATGTCTTTT TGTCTGTTGA TTGGATTCAG ACAAACAAAG GCTTTGGGAG ATTCAGAGAA GGACTACGAC
GAACTGAACT TCAGGATCAA GGGAGCAAAC ACTCGGGCAC GCCGTCTGCT TGGAAAATAA ACTGCAGAAT ATAATCTCAT
CACAGGACAG GAGTCCTTCC ATCCCTTTTA CCCTTAGTCT TGTGGAGGAT AATTAATTGT TTTGTGGGCC ATTGGTTCTG
ATGATTCTGT GCATCAGATT TTGATCAGTA CGGTGAATGG TTGGTCCTGG ATATGTCAGG GTATAATGTA TCTGTATATA
CTGCTATAGC CATTAGCCAG TAATGCTTTG TGCCATTGTT TTGGAATTTG GATCGTTCGC AATTGTTTCA AATCGCGTTA
GCATCAATAA AATTAGCAAT CTGCCAAGCC 

Locus: Os02g0437200

Loading...

Locus: Os02g0437200

Loading...