Os02t0437200-02

Locus

Os02g0437200

Description

SNAP25-type SNARE protein, Rice blast resistance

RAP-DB Gene Symbol Synonym(s)

OsSNAP32

RAP-DB Gene Name Synonym(s)

Synaptosome-associated protein of 32 kDa, Synaptosomal-associated protein 32

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSNAP32, SNAP32

Oryzabase Gene Name Synonym(s)

Synaptosomal-associated protein 32, Synaptosome-associated protein of 32 kD

Transcript Evidence

AY900120

Protein Evidence

Q5EEP3

Literature

PMID: 30617050

PMID: 17380428

DOI: 10.1007/s10725-016-0152-4

Note

Manual Curation

January 31, 2019

Functional domain (InterPro)

Target SNARE coiled-coil homology domain (IPR000727)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Others

Oryzabase (14681)

Transcript

1014 bp

>Os02t0437200-02 SNAP25-type SNARE protein, Rice blast resistance
AGATGAGCGGGAGGAGATCGTTCTTCGCATCCAAGAAGCCGTCGCGGAGCAGCAACCCCT
TCGACTCCGACTCCGACGATGGCGGGAGGGAGCAGAGACCGGCGAGGGCCTCCTCCGTGC
CTCCTCCGGCCGACCAGCGGGGCTCCCTCTTCGGCGGCGGGGATGGCTTCTCCGCCTCGT
CGGCGGCGGCGAGGAGCCGGTACAGGAACGACTTCCGCGACACCGGCGGCGTGGAGGCCC
AGTCGGTGCAGGAGCTGGAGGGCTACGCGGCGTACAAGGCGGAGGAGACCACTCAGCGGG
TGCAGGGCTGCGTCCGCATCGCCGAGGAGATGAGGGATACCGCGTCCAAGAGCCTCGTCA
CCATACACCAGCAGGGCCAGCAGATCACGCGCACGCACATGATGACCCTCGACATCGACC
AGGATCTCTCCAGGAGCGAGAAGCTGCTGGGTGATCTTGGGGGTATATTTTCCAAAAAGT
GGAAGCCAAAAAAGAATGGAGAAATCAGGGGGCCTATGCTAACTAGAGATGATTCCTTCA
TTCGGAAGGGCAGCCATTTGGAACAAAGGCACAAACTGGGACTATCGGATCACCCACCTC
AATCGAATGCACGCCAATTCCATTCCGAGCCAACTTCAGCCCTCCAGAAAGTGGAGATGG
AGAAGGCAAAGCAGGATGATGGCCTATCTGATCTAAGTAACATATTGACCGAGCTGAAAG
GCATGGCGGTTGACATGGGCACTGAGATTGACAGACAAACAAAGGCTTTGGGAGATTCAG
AGAAGGACTACGACGAACTGAACTTCAGGATCAAGGGAGCAAACACTCGGGCACGCCGTC
TGCTTGGAAAATAAACTGCAGAATATAATCTCATCACAGGACAGGAGTCCTTCCATCCCT
TTTACCCTTAGTCTTGTGGAGGATAATTAATTGTTTTGTGGGCCATTGGTTCTGATGATT
CTGTGCATCAGATTTTGATCAGTACGGTGAATGGTTGGTCCTGGATATGTCAGG

CDS

852 bp

>Os02t0437200-02 SNAP25-type SNARE protein, Rice blast resistance
ATGAGCGGGAGGAGATCGTTCTTCGCATCCAAGAAGCCGTCGCGGAGCAGCAACCCCTTC
GACTCCGACTCCGACGATGGCGGGAGGGAGCAGAGACCGGCGAGGGCCTCCTCCGTGCCT
CCTCCGGCCGACCAGCGGGGCTCCCTCTTCGGCGGCGGGGATGGCTTCTCCGCCTCGTCG
GCGGCGGCGAGGAGCCGGTACAGGAACGACTTCCGCGACACCGGCGGCGTGGAGGCCCAG
TCGGTGCAGGAGCTGGAGGGCTACGCGGCGTACAAGGCGGAGGAGACCACTCAGCGGGTG
CAGGGCTGCGTCCGCATCGCCGAGGAGATGAGGGATACCGCGTCCAAGAGCCTCGTCACC
ATACACCAGCAGGGCCAGCAGATCACGCGCACGCACATGATGACCCTCGACATCGACCAG
GATCTCTCCAGGAGCGAGAAGCTGCTGGGTGATCTTGGGGGTATATTTTCCAAAAAGTGG
AAGCCAAAAAAGAATGGAGAAATCAGGGGGCCTATGCTAACTAGAGATGATTCCTTCATT
CGGAAGGGCAGCCATTTGGAACAAAGGCACAAACTGGGACTATCGGATCACCCACCTCAA
TCGAATGCACGCCAATTCCATTCCGAGCCAACTTCAGCCCTCCAGAAAGTGGAGATGGAG
AAGGCAAAGCAGGATGATGGCCTATCTGATCTAAGTAACATATTGACCGAGCTGAAAGGC
ATGGCGGTTGACATGGGCACTGAGATTGACAGACAAACAAAGGCTTTGGGAGATTCAGAG
AAGGACTACGACGAACTGAACTTCAGGATCAAGGGAGCAAACACTCGGGCACGCCGTCTG
CTTGGAAAATAA

Protein

284 aa

>Os02t0437200-02 SNAP25-type SNARE protein, Rice blast resistance
MSGRRSFFASKKPSRSSNPFDSDSDDGGREQRPARASSVPPPADQRGSLFGGGDGFSASS
AAARSRYRNDFRDTGGVEAQSVQELEGYAAYKAEETTQRVQGCVRIAEEMRDTASKSLVT
IHQQGQQITRTHMMTLDIDQDLSRSEKLLGDLGGIFSKKWKPKKNGEIRGPMLTRDDSFI
RKGSHLEQRHKLGLSDHPPQSNARQFHSEPTSALQKVEMEKAKQDDGLSDLSNILTELKG
MAVDMGTEIDRQTKALGDSEKDYDELNFRIKGANTRARRLLGK*

5'UTR

chr02:13951399..13951400 (- strand) : 2 bp

CDS

chr02:13950967..13951398 (- strand) : 432 bp

chr02:13950627..13950720 (- strand) : 94 bp

chr02:13950363..13950490 (- strand) : 128 bp

chr02:13950191..13950288 (- strand) : 98 bp

chr02:13949721..13949820 (- strand) : 100 bp

3'UTR

chr02:13949561..13949720 (- strand) : 160 bp

FASTA

>Os02t0437200-02 class=Sequence position=chr02:13949561..13951400 (- strand)
AGATGAGCGG GAGGAGATCG TTCTTCGCAT CCAAGAAGCC GTCGCGGAGC AGCAACCCCT TCGACTCCGA CTCCGACGAT
GGCGGGAGGG AGCAGAGACC GGCGAGGGCC TCCTCCGTGC CTCCTCCGGC CGACCAGCGG GGCTCCCTCT TCGGCGGCGG
GGATGGCTTC TCCGCCTCGT CGGCGGCGGC GAGGAGCCGG TACAGGAACG ACTTCCGCGA CACCGGCGGC GTGGAGGCCC
AGTCGGTGCA GGAGCTGGAG GGCTACGCGG CGTACAAGGC GGAGGAGACC ACTCAGCGGG TGCAGGGCTG CGTCCGCATC
GCCGAGGAGA TGAGGGATAC CGCGTCCAAG AGCCTCGTCA CCATACACCA GCAGGGCCAG CAGATCACGC GCACGCACAT
GATGACCCTC GACATCGACC AGGATCTCTC CAGGGTAACT AACACAAACT AATAACTAAT ACTATGTGAT TACTCAGAAG
CCTGATTAAT TCTGTTTGAT CACATAGTGG CGTAACAAGT CCCCACCAAA ATTGGCCTGT TTCCTTCAGA ATTCCATCCT
TAATAAGTCC ACGAAAACTG AAACAAACTT CGTGTCACAC TTCAGAAATT AATTGCCAAC TCCAAATTTA CTGTATTATG
TGGTAATAAT GGCTAAAGGG AATTCTTCGC ACCTTTTCAG AGCGAGAAGC TGCTGGGTGA TCTTGGGGGT ATATTTTCCA
AAAAGTGGAA GCCAAAAAAG AATGGAGAAA TCAGGGGGCC TATGCTAACT AGAGGTAATC TCCAACTCTA GTCTTGAAAT
AGTAGACTGC AACAACAGTT GCTGACAGGG AAAGCTTGTA CTATGTGGTA TCACTTATCA GTTATGTTCT CTGTGTAACT
AACTGGAAGG ATGGAATTAC TTGTATGCAG ATGATTCCTT CATTCGGAAG GGCAGCCATT TGGAACAAAG GCACAAACTG
GGACTATCGG ATCACCCACC TCAATCGAAT GCACGCCAAT TCCATTCCGA GCCAACTTCA GCCCTCCAGA AAGTGGAGGT
AATGCGCTAA GACATATATG GTGATTGATT TGCTAAGTGT GTGTATTCTG ATTATCTTGT TGTGTTGCTC AGATGGAGAA
GGCAAAGCAG GATGATGGCC TATCTGATCT AAGTAACATA TTGACCGAGC TGAAAGGCAT GGCGGTTGAC ATGGGCACTG
AGATTGACAG GTGAATGCCA CATTTTTCAC TTTAGTTCAT AAAAACTAAT ACACACTTGT TTTTTCTGAG ATTGGCGTAT
TGTTATGTGG AATCCCTTTT TTGTGCTCTA ATTCCAGCGT ACTTTTATAG TTTGTACTAA CTGCCAGTTT ATGTTTAGTC
CATTCTTTAA AAATTTTCAC TTCTTCATGC TGAACGAACT AAAAAGGAGT AAAAAGTTTG GCCAAAGTAC CTTCAAATTC
AAGCGGCAAA TTACTTCCTA ATATCTAATC TGGAACACTT TGCATAATTA TATTTAAATC TGATGAGTAT TGTTGCTTTA
ACAGTCCAAC CAATAAAAAT CATCATGTGA TATGTCTTTT TGTCTGTTGA TTGGATTCAG ACAAACAAAG GCTTTGGGAG
ATTCAGAGAA GGACTACGAC GAACTGAACT TCAGGATCAA GGGAGCAAAC ACTCGGGCAC GCCGTCTGCT TGGAAAATAA
ACTGCAGAAT ATAATCTCAT CACAGGACAG GAGTCCTTCC ATCCCTTTTA CCCTTAGTCT TGTGGAGGAT AATTAATTGT
TTTGTGGGCC ATTGGTTCTG ATGATTCTGT GCATCAGATT TTGATCAGTA CGGTGAATGG TTGGTCCTGG ATATGTCAGG

Locus: Os02g0437200

Loading...

Locus: Os02g0437200

Loading...