Os02t0462800-01

Locus

Os02g0462800

Description

WRKY transcription factor 42, Transcriptional repressor, Promotion of leaf senescence

RAP-DB Gene Symbol Synonym(s)

WRKY42, OsWRKY42

RAP-DB Gene Name Synonym(s)

WRKY GENE 42, Rice WRKY gene42

CGSNL Gene Symbol

WRKY42

CGSNL Gene Name

WRKY GENE 42

Oryzabase Gene Symbol Synonym(s)

OsWRKY42, WRKY-42

Oryzabase Gene Name Synonym(s)

Rice WRKY gene42, WRKY transcription factor 42

Transcript Evidence

AK110587

AY676923 (Guang Lu Ai, indica)

Protein Evidence

Q6K4Y7

Q6IEN9

Literature

PMID: 25081037

PMID: 16919842

PMID: 15047897

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

July 10, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zn-cluster domain (IPR018872)

DNA-binding WRKY (IPR003657)

Full-length cDNA

002-168-F03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0462800-01)

RiceXPro (AK110587)

Others

Oryzabase (6556)

KEGG (Os02t0462800-01)

Transcript

1042 bp

>Os02t0462800-01 WRKY transcription factor 42, Transcriptional repressor, Promotion of leaf senescence
CAATTTTGCTTTGCTTGCTTCTCGCCGCGATCGCGCGCCATGGCGGATCCGTTCCCGGCG
GCGGCGCGCGGCGGCGAGCAGGGTGGTGGCACCGCGGGGCAGCTGGTGTCGACGCCGTCC
AGGTTGAGGACGGCGGTGGCGTCCATGCTCAACCGCACCGGCCACGCGCGCTTCCGCCGC
GCCGCCCCCGTCGTCGTGCAGGAGGAGGAGGATGAGGCGGCGGCGGCGGCGAGGGATGCG
GTCGTGCGGTGTGACGGGCTCAGCGCGTCGGCCAGCTCGTCGTTCCCGTCGTCGGTGACG
GGGGTCACCGGCGATGGGAGCGTGTCCAACGCCCGCGCGGTGCTCCCGGCGGCAGGCGAC
GGCGACAAGCCGCCACCAATGCAGTCTGCTTCAGATTATGCTTCTGATGGCCGCCTCAAA
CGCAGCAGCGACGACGACGGCGAGCGCTGCCACTGCTCCAAGAAAAAACGGAAGGCGTCG
TGGAGGGCGAGGCGGCGCATCCGCGTGCCGGCGATCAGCTCACGGAACGCCGACATCCCG
GCGGACGACTATTcgtggcgcaagtacggccagaagcccatcaaaggctcgccttatcca
cgcgggtactacaagtgcagcacggtgcgcgggtgcccggcgcggaagcacgtggagcgc
gaccccggcgagccggccatgctcatcgtcacctacgacggcgaccaccgccacGGGGAA
CCCGGCCATCGACGTCCCGATGAGGCGGCAACGACGACGGAGCACAGGACGACTGACCAA
ACTACTGGAAGATTGCTCTAGATAGTAGTGTCTATGCATGTAGACTCTATAATCTATATA
TAGAAACAAACTAATCTAATCAATTGACCGTTTGAATATTGGTTAATTTCTTAGTGCTCT
TTCATGCACGTAGTATTTGCCAATTGCCATGTACATCATATCTAGTTTAGACTATTGACT
GATGTGATATCCATGTAATTGATCTGCTACCTCCCTCACTCTCTTGATTAAGTATATGAT
GGTTGATATTTTCATGGTTTTT

CDS

762 bp

>Os02t0462800-01 WRKY transcription factor 42, Transcriptional repressor, Promotion of leaf senescence
ATGGCGGATCCGTTCCCGGCGGCGGCGCGCGGCGGCGAGCAGGGTGGTGGCACCGCGGGG
CAGCTGGTGTCGACGCCGTCCAGGTTGAGGACGGCGGTGGCGTCCATGCTCAACCGCACC
GGCCACGCGCGCTTCCGCCGCGCCGCCCCCGTCGTCGTGCAGGAGGAGGAGGATGAGGCG
GCGGCGGCGGCGAGGGATGCGGTCGTGCGGTGTGACGGGCTCAGCGCGTCGGCCAGCTCG
TCGTTCCCGTCGTCGGTGACGGGGGTCACCGGCGATGGGAGCGTGTCCAACGCCCGCGCG
GTGCTCCCGGCGGCAGGCGACGGCGACAAGCCGCCACCAATGCAGTCTGCTTCAGATTAT
GCTTCTGATGGCCGCCTCAAACGCAGCAGCGACGACGACGGCGAGCGCTGCCACTGCTCC
AAGAAAAAACGGAAGGCGTCGTGGAGGGCGAGGCGGCGCATCCGCGTGCCGGCGATCAGC
TCACGGAACGCCGACATCCCGGCGGACGACTATTcgtggcgcaagtacggccagaagccc
atcaaaggctcgccttatccacgcgggtactacaagtgcagcacggtgcgcgggtgcccg
gcgcggaagcacgtggagcgcgaccccggcgagccggccatgctcatcgtcacctacgac
ggcgaccaccgccacGGGGAACCCGGCCATCGACGTCCCGATGAGGCGGCAACGACGACG
GAGCACAGGACGACTGACCAAACTACTGGAAGATTGCTCTAG

Protein

254 aa

>Os02t0462800-01 WRKY transcription factor 42, Transcriptional repressor, Promotion of leaf senescence
MADPFPAAARGGEQGGGTAGQLVSTPSRLRTAVASMLNRTGHARFRRAAPVVVQEEEDEA
AAAARDAVVRCDGLSASASSSFPSSVTGVTGDGSVSNARAVLPAAGDGDKPPPMQSASDY
ASDGRLKRSSDDDGERCHCSKKKRKASWRARRRIRVPAISSRNADIPADDYSWRKYGQKP
IKGSPYPRGYYKCSTVRGCPARKHVERDPGEPAMLIVTYDGDHRHGEPGHRRPDEAATTT
EHRTTDQTTGRLL*

5'UTR

chr02:15521497..15521535 (+ strand) : 39 bp

CDS

chr02:15521536..15521966 (+ strand) : 431 bp

chr02:15522054..15522185 (+ strand) : 132 bp

chr02:15522283..15522481 (+ strand) : 199 bp

3'UTR

chr02:15522482..15522722 (+ strand) : 241 bp

FASTA

>Os02t0462800-01 class=Sequence position=chr02:15521497..15522722 (+ strand)
CAATTTTGCT TTGCTTGCTT CTCGCCGCGA TCGCGCGCCA TGGCGGATCC GTTCCCGGCG GCGGCGCGCG GCGGCGAGCA
GGGTGGTGGC ACCGCGGGGC AGCTGGTGTC GACGCCGTCC AGGTTGAGGA CGGCGGTGGC GTCCATGCTC AACCGCACCG
GCCACGCGCG CTTCCGCCGC GCCGCCCCCG TCGTCGTGCA GGAGGAGGAG GATGAGGCGG CGGCGGCGGC GAGGGATGCG
GTCGTGCGGT GTGACGGGCT CAGCGCGTCG GCCAGCTCGT CGTTCCCGTC GTCGGTGACG GGGGTCACCG GCGATGGGAG
CGTGTCCAAC GCCCGCGCGG TGCTCCCGGC GGCAGGCGAC GGCGACAAGC CGCCACCAAT GCAGTCTGCT TCAGATTATG
CTTCTGATGG CCGCCTCAAA CGCAGCAGCG ACGACGACGG CGAGCGCTGC CACTGCTCCA AGAAAAAACG GTGATTAAAC
ACACACACCT GCACGGCTGC AAGGACTTGA TCGATTTGCT CCAAAACGAC ATTAACGATT CTGTGATGAA CTTGCAGGAA
GGCGTCGTGG AGGGCGAGGC GGCGCATCCG CGTGCCGGCG ATCAGCTCAC GGAACGCCGA CATCCCGGCG GACGACTATT
cgtggcgcaa gtacggccag aagcccatca aaggctcgcc ttatccacgg taacacatcg atttctgaat atctgaccgt
gcgatggaga gatattccga cggcggacac tgactccacg tactatacgt acgttacata ttgcagcggg tactacaagt
gcagcacggt gcgcgggtgc ccggcgcgga agcacgtgga gcgcgacccc ggcgagccgg ccatgctcat cgtcacctac
gacggcgacc accgccacGG GGAACCCGGC CATCGACGTC CCGATGAGGC GGCAACGACG ACGGAGCACA GGACGACTGA
CCAAACTACT GGAAGATTGC TCTAGATAGT AGTGTCTATG CATGTAGACT CTATAATCTA TATATAGAAA CAAACTAATC
TAATCAATTG ACCGTTTGAA TATTGGTTAA TTTCTTAGTG CTCTTTCATG CACGTAGTAT TTGCCAATTG CCATGTACAT
CATATCTAGT TTAGACTATT GACTGATGTG ATATCCATGT AATTGATCTG CTACCTCCCT CACTCTCTTG ATTAAGTATA
TGATGGTTGA TATTTTCATG GTTTTT

Locus: Os02g0462800

Loading...

Locus: Os02g0462800

Loading...