Os02t0465900-01

Locus

Os02g0465900

Description

Vacuolar antiporter-regulating protein, Compartmentation of Na+ into vacuole, Salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsARP, OsCTP

RAP-DB Gene Name Synonym(s)

antiporter-regulating protein

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsARP, OsCTP

Oryzabase Gene Name Synonym(s)

antiporter regulating protein, antiporter-regulating protein, cation transporter, cation transport protein, pistil extensin like protein

Transcript Evidence

AK071205

AK104187

AK104223

AK104241

AK104351

AK104503

AK104516

AK119187

Protein Evidence

Q6K7C2

Literature

PMID: 18420595

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

January 28, 2021

Gene Ontology (GO)

Biological Process: glutathione catabolic process (GO:0006751)

Molecular Function: gamma-glutamylcyclotransferase activity (GO:0003839)

Functional domain (InterPro)

Glutathione-specific gamma-glutamylcyclotransferase (IPR006840)

Gamma-glutamyl cyclotransferase-like (IPR013024)

Experimentally confirmed subcellular location

tonoplast (GO:0009705)

Full-length cDNA

J023085D08 (Online Clone Ordering)

006-302-G08 (Online Clone Ordering)

006-306-E10 (Online Clone Ordering)

006-308-B07 (Online Clone Ordering)

001-034-G09 (Online Clone Ordering)

006-302-F05 (Online Clone Ordering)

006-303-C03 (Online Clone Ordering)

001-039-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0465900-01)

Others

Oryzabase (10371)

Transcript

1128 bp

>Os02t0465900-01 Vacuolar antiporter-regulating protein, Compartmentation of Na+ into vacuole, Salt tolerance
CTCTCACCAACAACAGTAACCCAACCAGAGAGCTTGCGGAAGCGGGGGTTTGGTGCGGGC
GCGCGCGTGTGAGGGGGGAGAGAAGGCCAGGAGGAGGCGACGCCGTCGCCCGAGGGAGGC
AAAAATCCGATCCTCCTCCTGCCCTGCTCGCTCGCTCGCTCGCCTGCGCTGCGCGCACTT
GGCCCCGTCCCGTCCGTTCCCGCTCGCCAGGCATAGAAAGATGGTGCTCTGGGTCTTCGG
CTATGGCTCCCTGATCTGGAACCCCGGATTCGACTTCGATGAGAAGATCCTGGGCTTCGT
CAAGGGCTACAAACGCACCTTCAATCTTGCTTGCATTGACCATCGGGGCACGCCGGAGCA
TCCTGCGAGGACCTGCACACTTGAGTCCGACGAGGAAGCCATATGCTGGGGGATTGCATA
CTGTGTCAAAGGGGGGCTTAAAAAGGAGCAAGAAGCAATGAAGTACTTGGAAAGAAGAGA
GTGTGAGTATGACCAGAAGATCTCTGTGGATTTCTACAAGGAAGGAGATTCTTTGAAGCC
AGCTGTGACAGGTGTACTAGTCTTTGTATCCACTCCTGATCCAGTAGGCAACAAATACTA
TCTTGGGCCTGCTCCTTTGGAGGACATGGCAAGGCAAATTGCTACAGCCAATGGCCCCAA
TGGGAATAACAGGGATTACCTGTTCTCAATGGAGAAGGCATTGTCCAACATATGCCATGA
AGATGATTCAATCATCGAGCTAGCTAACGAGGTCAGGAAGGTGTTGAGCCGGCCGAAGGA
GAAGATCACTGGCTCCGATAGCCCACAAAAATCTCACGCTCTCGTACACCTGTCTGCGCT
TCCTGAGGGCACTGTTGTGGACTCAAGATAGCAAGCTCGGCGGTGGAAGAGATGAGATCT
CCTCTGACCTACTCACTCTTGACGCTGGATTGAACGAGTTTAACAGTCTGCTTCGAGCTC
CCTGGCACACTGGGGAACCAGAATGTGCTGATTTTCTTTCGCAACCGCTGCGGCAATGCT
GTAACTTTCATTTTGCTAATACTAGAGCCGAGACTGGTGTGCTGCTGTTTCCTTTGACAC
ACTAAATAATAAAGGGATTCCATGAGCTTTTCACTCTTGAGCTGTTGC

CDS

651 bp

>Os02t0465900-01 Vacuolar antiporter-regulating protein, Compartmentation of Na+ into vacuole, Salt tolerance
ATGGTGCTCTGGGTCTTCGGCTATGGCTCCCTGATCTGGAACCCCGGATTCGACTTCGAT
GAGAAGATCCTGGGCTTCGTCAAGGGCTACAAACGCACCTTCAATCTTGCTTGCATTGAC
CATCGGGGCACGCCGGAGCATCCTGCGAGGACCTGCACACTTGAGTCCGACGAGGAAGCC
ATATGCTGGGGGATTGCATACTGTGTCAAAGGGGGGCTTAAAAAGGAGCAAGAAGCAATG
AAGTACTTGGAAAGAAGAGAGTGTGAGTATGACCAGAAGATCTCTGTGGATTTCTACAAG
GAAGGAGATTCTTTGAAGCCAGCTGTGACAGGTGTACTAGTCTTTGTATCCACTCCTGAT
CCAGTAGGCAACAAATACTATCTTGGGCCTGCTCCTTTGGAGGACATGGCAAGGCAAATT
GCTACAGCCAATGGCCCCAATGGGAATAACAGGGATTACCTGTTCTCAATGGAGAAGGCA
TTGTCCAACATATGCCATGAAGATGATTCAATCATCGAGCTAGCTAACGAGGTCAGGAAG
GTGTTGAGCCGGCCGAAGGAGAAGATCACTGGCTCCGATAGCCCACAAAAATCTCACGCT
CTCGTACACCTGTCTGCGCTTCCTGAGGGCACTGTTGTGGACTCAAGATAG

Protein

217 aa

>Os02t0465900-01 Vacuolar antiporter-regulating protein, Compartmentation of Na+ into vacuole, Salt tolerance
MVLWVFGYGSLIWNPGFDFDEKILGFVKGYKRTFNLACIDHRGTPEHPARTCTLESDEEA
ICWGIAYCVKGGLKKEQEAMKYLERRECEYDQKISVDFYKEGDSLKPAVTGVLVFVSTPD
PVGNKYYLGPAPLEDMARQIATANGPNGNNRDYLFSMEKALSNICHEDDSIIELANEVRK
VLSRPKEKITGSDSPQKSHALVHLSALPEGTVVDSR*

5'UTR

chr02:15679251..15679460 (- strand) : 210 bp

chr02:15678979..15678988 (- strand) : 10 bp

CDS

chr02:15678870..15678978 (- strand) : 109 bp

chr02:15678659..15678735 (- strand) : 77 bp

chr02:15677562..15677618 (- strand) : 57 bp

chr02:15677419..15677475 (- strand) : 57 bp

chr02:15677288..15677328 (- strand) : 41 bp

chr02:15677130..15677201 (- strand) : 72 bp

chr02:15676960..15677039 (- strand) : 80 bp

chr02:15676577..15676734 (- strand) : 158 bp

3'UTR

chr02:15676320..15676576 (- strand) : 257 bp

FASTA

>Os02t0465900-01 class=Sequence position=chr02:15676320..15679460 (- strand)
CTCTCACCAA CAACAGTAAC CCAACCAGAG AGCTTGCGGA AGCGGGGGTT TGGTGCGGGC GCGCGCGTGT GAGGGGGGAG
AGAAGGCCAG GAGGAGGCGA CGCCGTCGCC CGAGGGAGGC AAAAATCCGA TCCTCCTCCT GCCCTGCTCG CTCGCTCGCT
CGCCTGCGCT GCGCGCACTT GGCCCCGTCC CGTCCGTTCC CGCTCGCCAG GTGATTTCTT GCAGCCATTT TTCCCCGAGA
TTACATGGTT TGTGGGGTTA GTTGGGTGGG TGGTGATGCC ATTGTTGCGT CGAATGGCCC GCTGGGGTTG GATTTGAGGT
CGCAATCCTC GTCGGTGTGC CCCGAATAGA GTGATTCTTG TCTGCTTCGG GGGATCTCGA TTTGGGGATT AGGAGAAGCT
TTACAATCTT CTCGATAGTA TACAAGATTT TCTTTCTGAT TTATCTGCTG TTTTTGCGCT CAAAATGTGC AGGCATAGAA
AGATGGTGCT CTGGGTCTTC GGCTATGGCT CCCTGATCTG GAACCCCGGA TTCGACTTCG ATGAGAAGAT CCTGGGCTTC
GTCAAGGGCT ACAAACGCAC CTTCAATCTT GGTACGATAG ATTTACTCCT GGTTGTCTTG GAAAATGGGC TTGGAAATGC
AGAATCAGTA GCTTAAACTT GCCGCTGTTC TATATTGGCC TCAACTTTTA TGTGTGCATC TTCATATTTT TCTTCCTCCC
TGCAGCTTGC ATTGACCATC GGGGCACGCC GGAGCATCCT GCGAGGACCT GCACACTTGA GTCCGACGAG GAAGCCATAT
GCGTAAGCGA GCTGTCATCT TCGTTTTCCC ATTTCACCGA TGCACCGCAT TGAAATTTTT GCACTGAATT GAAGCATACT
TCACTTATTG TGCTATATAT AAATACAACT ATCTTGACGA TTCTTCCGTA GGATTTGCAT CGGTGACATT ACCGATACTC
TGTTGAACCT TGTAGATGCT TTTGTTTTAG GAAATAGCCA TACAAAATGG TAAGTTTTGA TGACAATTAA AATAACCTTC
TTAAAGGTGT CAATGATTTT GGAGAAATAA CTGCTACATG AGGGATTTTT TTTAATTGAA TACTTCAGTT TTAAATAGTC
TCTTGTGCAG GACTGGAGAG AAAAGTTGCT TCTGTGCCTT GCTTGATTTG TTATTTGGGA GAGGAATACA ACAGTAACTA
ACTCTATAAC ATCATTAGAA AAAGAACACA ATAACCCTGT AGCCTCCCTC ATCATAGGGG CATACTGACC TTCACTGTTC
GAATTTCCAA TAACCTATAG TTTTTTTGAC TAAAAAAACG ACTCTGCAAT AACCTCTAGT AACTTACTCA CATTGGTATG
GTGGATCGGC AGTCTGCAGA TTAGCTTAAT GCAAAGCATG ACTGACCAAC TCATGCACCT GATATTTACA GTTTGACATA
TCATGCTGAG CAGTGGCACC AAAGCACAAT CCTATTAGGG ACTCAAAAGC TCATGTAAAG CAGATGACTA CTGGAAATCT
GGAATCAGAT GGCAGATGAC TGAGCAGGAA TCTGCCGGTG GATTCTCCTC ACAAACCATG CTTTACACTC TTGTGCTATT
TGTCTCTTGT TTTGGTCCAA AGACACGTCA TTTGCCTTAA TTCATAACAT ACAGGCAGGA CATGAACTCA AACCAGATTT
ACTGTTTTAG CAAGTTCTGT GCACTGAAAA TCATTATCCT GACATATGTG ACTTTGCTCA GGCTTTATCA TTACCACAGA
GATGTTAGTT TTACTAATTT CCAAAGATTC ATTTCTGAAT ATTATATCAG CTGTATTTAC AGTCCGATAT GAATATTTGC
AGTGGGGGAT TGCATACTGT GTCAAAGGGG GGCTTAAAAA GGAGCAAGAA GCAATGAAGG TTGGTGCTTC TTTTCCTTGT
AGATTAAAAG AATGAGTAGA TTTATGAGGC TAGAATTATC TTGACAAATT TATTTTGCAA TTCAGTACTT GGAAAGAAGA
GAGTGTGAGT ATGACCAGAA GATCTCTGTG GATTTCTACA AGGTACTCGT TTTGCATCAG GCATTATTTT AGAAAATAAA
AGTCAATTAT TTGCATTACT CTAATATCCT ATTGTTGAAT TTTATTGTTT AGGAAGGAGA TTCTTTGAAG CCAGCTGTGA
CAGGTGTACT AGTGTAAGGG TTCAAACTGC ACGATTGAAA TTTCCATGAT ATAACTTGTT AATTTTCTGT TTAACTCACT
TACTTTGGTG CTTGTGCAGC TTTGTATCCA CTCCTGATCC AGTAGGCAAC AAATACTATC TTGGGCCTGC TCCTTTGGAG
GACATGGCAA GGTGGGCTAT TCATCTCATG GTGCACTTTT ACTGGCTTAC TGCTTGATTA GCATCATTTT CTGACTACTT
GATCATTTTT TTTAATACCA GGCAAATTGC TACAGCCAAT GGCCCCAATG GGAATAACAG GGATTACCTG TTCTCAATGG
AGAAGGCATT GTCCAACATA TGTAAGAAAA AGATCTTTTT ACGATATCTT TATTTGATCA AAGCTCATGA CATACTCATT
TCTAATATTC CTATTCATTT TTTTATATAA AAAAAATGAC TGCATCAGTT TTCAGTACAT GTATGTGCTA GTTGATGGCC
TGCTGCTTAT ATATTTGGAC AACAGGACCG CACTCACAGA GATTTTCATA GTATAATTAC AAATGATGCT ACGTTGCTTT
GTTCAGGCCA TGAAGATGAT TCAATCATCG AGCTAGCTAA CGAGGTCAGG AAGGTGTTGA GCCGGCCGAA GGAGAAGATC
ACTGGCTCCG ATAGCCCACA AAAATCTCAC GCTCTCGTAC ACCTGTCTGC GCTTCCTGAG GGCACTGTTG TGGACTCAAG
ATAGCAAGCT CGGCGGTGGA AGAGATGAGA TCTCCTCTGA CCTACTCACT CTTGACGCTG GATTGAACGA GTTTAACAGT
CTGCTTCGAG CTCCCTGGCA CACTGGGGAA CCAGAATGTG CTGATTTTCT TTCGCAACCG CTGCGGCAAT GCTGTAACTT
TCATTTTGCT AATACTAGAG CCGAGACTGG TGTGCTGCTG TTTCCTTTGA CACACTAAAT AATAAAGGGA TTCCATGAGC
TTTTCACTCT TGAGCTGTTG C

Locus: Os02g0465900

Loading...

Locus: Os02g0465900

Loading...