Os02t0513100-01

Locus

Os02g0513100

Description

Clade III SWEET transporter, Sucrose transporter, Regulation of sucrose transport in response to drought and salt stress, TAL effector-mediated susceptibility to bacterial pathogen

RAP-DB Gene Symbol Synonym(s)

OsSWEET15

RAP-DB Gene Name Synonym(s)

Sugars Will Eventually be Exported Transporter 15

CGSNL Gene Symbol

SWEET15

CGSNL Gene Name

SWEET15

Oryzabase Gene Symbol Synonym(s)

OsSWEET15

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK103266

Protein Evidence

Q6K602

Literature

PMID: 32940908

PMID: 23879865

Note

Manual Curation

September 23, 2020

Gene Ontology (GO)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

SWEET sugar transporter (IPR004316)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J033124G19 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0513100-01)

RiceXPro (AK103266)

Others

Oryzabase (9106)

KEGG (Os02t0513100-01)

Transcript

1562 bp

>Os02t0513100-01 Clade III SWEET transporter, Sucrose transporter, Regulation of sucrose transport in response to drought and salt stress, TAL effector-mediated susceptibility to bacterial pathogen
CATGAACCCAAGCCACATCTTAGCTTAATTACATAGCTCCTCCTCCTTTCTCCACTGACT
GCTCAGTGTGTTTTGCATCTCTCCATTGAGCAAGAGGAGAAGGGAGGCTCAGCTAGCTAG
CTAGCTACCATCTATACTAGTATCAAGTTTTTTTGTTCAGATTTTTTTGTTGGAGGAAGA
GTTCTAGGGAGATCGATATGGCCTTCATGTCCATGGAACGCAGCACTTGGGCCTTCACCT
TTGGCATCTTAGGTAACTTAATCTCACTAATGGTATTCCTTTCGCCACTGCCGACGTTCT
ACCGGGTGTACCGGAAGAAGTCGACGGAGGGGTTCCAGTCGACGCCGTACGTGGTGACGC
TCTTCAGCTGCATGCTGTGGATGTACTACGCGTTCGTCAAGTCCGGCGCCGAGCTGCTGG
TCACCATCAATGGTGTGGGGTGCGTCATCGAGACCGTCTACCTCGCCATGTACCTCGCCT
ACGCCCCCAAGAGCGCCAGGATGCTCACGGCGAAGATGCTGCTCGGCCTCAACATCGGCC
TCTTCGGCGTCATCGCGCTCGTCACGCTGCTGCTCTCCCGCGGCGAGCTCCGCGTCCACG
TCCTCGGCTGGATCTGCGTCGCCGTCTCGCTCAGCGTCTTCGCCGCTCCCTTGAGCATCA
TCAGGCTGGTGATCCGGACCAAGAGCGTGGAGTTCATGCCATTCTCGCTATCCTTCTTCC
TGGTGCTTAGCGCGGTGATCTGGTTCTTGTACGGGCTGCTCAAGAAGGACGTGTTCGTGG
CGCTGCCCAACGTGCTGGGCTTCGTGTTCGGCGTGGCGCAGATGGCGCTGTACATGGCGT
ACCGGAGCAAGAAGCCACTGGTGGCGTCGTCGTCGTCCGCCGTGGTGGCGGCCGGGCTGG
AGATCAAGCTGCCGGAGCATGTCAAGGAGGTGCAGGCCGTCGCCAAGGGCGCCGTCGCGG
CAGCGCCGGAGGGCAGGATCAGCTGCGGCGCGGAGGTGCACCCCATCGACGACGTGATGC
CCTCGGAGGTGGTGGAGGTGAAGGTGGATGACGAGGAGACGAACCGTACGGACGAGATGG
CCGGTGACGGCGATCACGCTATGGTCAGAACGGAGCAGATCATCAAGCCTGACATGGCCA
TTGTTGTGGAAGTGTAGTCTGATTAAGCTTAGAGAACTAGTAGTAATTCTCTCATGTGAG
GTATAGCCAGCTAGCTGGTGGTACACAAACATAAACACGAACACATGTTCATCGCGTACG
TACTAGCTACTAGGTGAGACACCTCTTGGCGTAGTACGTACAGTAGTACTCCGGCCAGAT
CTAGTAGGGACTGTATTGGCGCGTGACTCGCCTGGTTCGTCCAGCTTGCATGCAGAGACC
GACCGAGCAAGCAAGCTAATTAAGCTGGCCCGACCGACCGAGTGCATGCGTGTTTTGTGA
ACCTAGCTACTGAGGGGGGAGTGAAGGGTGTGGGTGTGCAATCGACCGGCCTGTCGCGTC
GATGCTCTTGCTTAGCTTCATTCGATTCATGCAGTTCAATAATAAAATTTGGATTTTACT
GC

CDS

960 bp

>Os02t0513100-01 Clade III SWEET transporter, Sucrose transporter, Regulation of sucrose transport in response to drought and salt stress, TAL effector-mediated susceptibility to bacterial pathogen
ATGGCCTTCATGTCCATGGAACGCAGCACTTGGGCCTTCACCTTTGGCATCTTAGGTAAC
TTAATCTCACTAATGGTATTCCTTTCGCCACTGCCGACGTTCTACCGGGTGTACCGGAAG
AAGTCGACGGAGGGGTTCCAGTCGACGCCGTACGTGGTGACGCTCTTCAGCTGCATGCTG
TGGATGTACTACGCGTTCGTCAAGTCCGGCGCCGAGCTGCTGGTCACCATCAATGGTGTG
GGGTGCGTCATCGAGACCGTCTACCTCGCCATGTACCTCGCCTACGCCCCCAAGAGCGCC
AGGATGCTCACGGCGAAGATGCTGCTCGGCCTCAACATCGGCCTCTTCGGCGTCATCGCG
CTCGTCACGCTGCTGCTCTCCCGCGGCGAGCTCCGCGTCCACGTCCTCGGCTGGATCTGC
GTCGCCGTCTCGCTCAGCGTCTTCGCCGCTCCCTTGAGCATCATCAGGCTGGTGATCCGG
ACCAAGAGCGTGGAGTTCATGCCATTCTCGCTATCCTTCTTCCTGGTGCTTAGCGCGGTG
ATCTGGTTCTTGTACGGGCTGCTCAAGAAGGACGTGTTCGTGGCGCTGCCCAACGTGCTG
GGCTTCGTGTTCGGCGTGGCGCAGATGGCGCTGTACATGGCGTACCGGAGCAAGAAGCCA
CTGGTGGCGTCGTCGTCGTCCGCCGTGGTGGCGGCCGGGCTGGAGATCAAGCTGCCGGAG
CATGTCAAGGAGGTGCAGGCCGTCGCCAAGGGCGCCGTCGCGGCAGCGCCGGAGGGCAGG
ATCAGCTGCGGCGCGGAGGTGCACCCCATCGACGACGTGATGCCCTCGGAGGTGGTGGAG
GTGAAGGTGGATGACGAGGAGACGAACCGTACGGACGAGATGGCCGGTGACGGCGATCAC
GCTATGGTCAGAACGGAGCAGATCATCAAGCCTGACATGGCCATTGTTGTGGAAGTGTAG

Protein

319 aa

>Os02t0513100-01 Clade III SWEET transporter, Sucrose transporter, Regulation of sucrose transport in response to drought and salt stress, TAL effector-mediated susceptibility to bacterial pathogen
MAFMSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML
WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIA
LVTLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV
IWFLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKKPLVASSSSAVVAAGLEIKLPE
HVKEVQAVAKGAVAAAPEGRISCGAEVHPIDDVMPSEVVEVKVDDEETNRTDEMAGDGDH
AMVRTEQIIKPDMAIVVEV*

5'UTR

chr02:18456940..18457136 (- strand) : 197 bp

CDS

chr02:18456885..18456939 (- strand) : 55 bp

chr02:18456243..18456279 (- strand) : 37 bp

chr02:18455411..18455783 (- strand) : 373 bp

chr02:18454813..18455307 (- strand) : 495 bp

3'UTR

chr02:18454408..18454812 (- strand) : 405 bp

FASTA

>Os02t0513100-01 class=Sequence position=chr02:18454408..18457136 (- strand)
CATGAACCCA AGCCACATCT TAGCTTAATT ACATAGCTCC TCCTCCTTTC TCCACTGACT GCTCAGTGTG TTTTGCATCT
CTCCATTGAG CAAGAGGAGA AGGGAGGCTC AGCTAGCTAG CTAGCTACCA TCTATACTAG TATCAAGTTT TTTTGTTCAG
ATTTTTTTGT TGGAGGAAGA GTTCTAGGGA GATCGATATG GCCTTCATGT CCATGGAACG CAGCACTTGG GCCTTCACCT
TTGGCATCTT AGGTACATAC AGGCATCAAC ATGCTCATGA ATGCTGCATT CATCTCATGC ATACGGTGGT CTTTCTAGCT
GTTATATTAG CTTACTCTGT TCCTTTGATT TGATTAATCC GTGCATGCAT GTTCTCCCAT ATTGTTGGAG ACACATTATG
GCAGCATGTA TCGATCTTAA TTCCCACAAC CGCACAAGCA ATGTCCCTGA AAACCGCAGC AAAACACCCA TTGGAATCAA
GTTTTCTTAG TTAACTAGAT CAATAATCTC CTTTGTTGCT TCTGTCACCT TAATTAGTAC TCCAGTGTGT CTTCCTCAAT
ATCTTTCAAA GCTAGTGTTT GAACAAAAAA AAAAGAACTA GTGTTTCTGT CCTGAATAAA TGGAACTGCT AAACAAAACT
TTTAGGCTCT AATCAGGTAG TTACTCTAAA CAGAGAAAGG GAGCCATCAC GCATGTTAGT TAGAAACGTA CACACCTTAT
TTTTTTCTCT TTTTAGTTTT TACCATGCAC CATGCATTTC TTTTCTCTGT TTGCCTCTCT CTCTCTCTCT CTCTCTCTCT
CTTTTGTATT GGCTGACATC ACTGATAACC CGTGTCTGCC TTTGATCTTT TTTGCAGGTA ACTTAATCTC ACTAATGGTA
TTCCTTTCGC CACTGTAAGC ACCTCAACTT GCTTCAATTT CTATCAAGCA CATGCATAAC ATTGTTTTGT TAGGTTTTTA
AAATAATAAT ACTAGTTCAG TATGTACAAA AAAAAAAGCA TCACACATGT CAATGATACA CATGAAGGGT CACCATCATC
TATACCATTC TAGAATTCAG CATACACCTG AAGGCAACAT AACTCTGAAG ATTTCTACTA ATGAATTCTC ACAATAGTCA
GCTGAAGGTG GAAAGAAAAA AAAAATCTCT CAGCACGTCA CTTTTAGCAG AGTAATTGTG TGTGTCCTTG TAGGCAGTTG
TAGTTCCATT ATTGAGACGA CACAGATCAA GCATGAGTTT AACTTCCATT AATCAGACGA AAGAAACTGC TGTTAGCTAG
TTTGTTGATA ACTAATTATT AGCAGGTTGA ACAATAACTT AACCGTGTGT GCATGCGTGC GTTTGGCGTG CAGGCCGACG
TTCTACCGGG TGTACCGGAA GAAGTCGACG GAGGGGTTCC AGTCGACGCC GTACGTGGTG ACGCTCTTCA GCTGCATGCT
GTGGATGTAC TACGCGTTCG TCAAGTCCGG CGCCGAGCTG CTGGTCACCA TCAATGGTGT GGGGTGCGTC ATCGAGACCG
TCTACCTCGC CATGTACCTC GCCTACGCCC CCAAGAGCGC CAGGATGCTC ACGGCGAAGA TGCTGCTCGG CCTCAACATC
GGCCTCTTCG GCGTCATCGC GCTCGTCACG CTGCTGCTCT CCCGCGGCGA GCTCCGCGTC CACGTCCTCG GCTGGATCTG
CGTCGCCGTC TCGCTCAGCG TCTTCGCCGC TCCCTTGAGC ATCATCGTAA GCTAGCAAAC GAATGCAATC TTGATGTCTT
GCTAACTAAT CGCTCGATCG ATCAACCAGC AGCTGATGAC AAGGTTCTGA TGATTGTTGT GTTTTGCAGA GGCTGGTGAT
CCGGACCAAG AGCGTGGAGT TCATGCCATT CTCGCTATCC TTCTTCCTGG TGCTTAGCGC GGTGATCTGG TTCTTGTACG
GGCTGCTCAA GAAGGACGTG TTCGTGGCGC TGCCCAACGT GCTGGGCTTC GTGTTCGGCG TGGCGCAGAT GGCGCTGTAC
ATGGCGTACC GGAGCAAGAA GCCACTGGTG GCGTCGTCGT CGTCCGCCGT GGTGGCGGCC GGGCTGGAGA TCAAGCTGCC
GGAGCATGTC AAGGAGGTGC AGGCCGTCGC CAAGGGCGCC GTCGCGGCAG CGCCGGAGGG CAGGATCAGC TGCGGCGCGG
AGGTGCACCC CATCGACGAC GTGATGCCCT CGGAGGTGGT GGAGGTGAAG GTGGATGACG AGGAGACGAA CCGTACGGAC
GAGATGGCCG GTGACGGCGA TCACGCTATG GTCAGAACGG AGCAGATCAT CAAGCCTGAC ATGGCCATTG TTGTGGAAGT
GTAGTCTGAT TAAGCTTAGA GAACTAGTAG TAATTCTCTC ATGTGAGGTA TAGCCAGCTA GCTGGTGGTA CACAAACATA
AACACGAACA CATGTTCATC GCGTACGTAC TAGCTACTAG GTGAGACACC TCTTGGCGTA GTACGTACAG TAGTACTCCG
GCCAGATCTA GTAGGGACTG TATTGGCGCG TGACTCGCCT GGTTCGTCCA GCTTGCATGC AGAGACCGAC CGAGCAAGCA
AGCTAATTAA GCTGGCCCGA CCGACCGAGT GCATGCGTGT TTTGTGAACC TAGCTACTGA GGGGGGAGTG AAGGGTGTGG
GTGTGCAATC GACCGGCCTG TCGCGTCGAT GCTCTTGCTT AGCTTCATTC GATTCATGCA GTTCAATAAT AAAATTTGGA
TTTTACTGC

Locus: Os02g0513100

Loading...

Locus: Os02g0513100

Loading...