Os02t0516400-01

Locus

Os02g0516400

Description

WW domain protein, Regulation of cuticle development

RAP-DB Gene Symbol Synonym(s)

CFL1

RAP-DB Gene Name Synonym(s)

curly flag leaf1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

CFL1

Oryzabase Gene Name Synonym(s)

curly flag leaf1

Transcript Evidence

Inferred from literature

Protein Evidence

Q0E0W7

Literature

PMID: 21954461

Note

Manual Curation

May 12, 2017

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WW domain (IPR001202)

Expression Databases

TENOR (Os02t0516400-00)

Others

Oryzabase (10526)

Transcript

1185 bp

>Os02t0516400-01 WW domain protein, Regulation of cuticle development
ATGACTGCCCCGAACATCGAGATGATCGCCTCGTCGCTGCGCAACTGCTCCCTCAACGGC
GGGGGAGGAGGAGGAGGAGGGCGGCGCAGGGGGAGGCGCGCGGCGGCGGCGGAGGGGAGC
GACGACAGCGAGGGGGTCACCGTCGAGCTCAACTCCGAGGTCGCCCTGCCCTACCACTGG
GAGCAGTGCCTCGACATCCGGACGGGGCAAGTTTACTACATCAACTGGGAGGACGGCACC
CGGACGACCATCGATCCGCGCTCGTCGTCGGCGTACTCGCCGTCGCCGGCGTCGCGGTCC
GCGTCGTCCTCCTCCCGCCGCTGCTCGCGCGCGCGGGGCCGCGGCGGCGGAGGCGGCGCC
GCCGCCGCGGCGTCGACCACCACGTCGTCGGGGTACACCTCCGTGTCGTCCGTGGGCGCG
GTCACCGCGGCGGCGGCGGCGTGGCGCTCGCACGACAGCAGCGGGCACGGCTACGGCTAC
GGCTACGGCTACGGCAGCTATGGCTACGGCTACGGCTACGACGGCCGCGACGGCGACGAC
GAGGAGAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCAGCGCCAGCAGCAGC
CGGGGCTCCGCCGTGTCGTCCACGCTCTCGTCGTTCTCCCCCACCGACGAGTCGGCCTCC
GGCGCCGGCAGCGGCTACGCCGTCGGCGACAACGGCGCCCACGTCCTCGTCGCCGCCGGC
TGCCGGGCTTGCTTCATGTACTTCATGGTGCCGAAGACCGCCGACGTGTGCCCCAAGTGC
GGCAGCTCCGGCCTCCTCCACCTCAGCCGCAACGGCTACGTCTGAGCCTCCGCCGCCGCC
GCCGTCCCCGCGCCGCCGCTCGCCGCCGCCGAGTTCCGCAATTCACTAATTGTAGGGGGG
CCTTCTCGCAATTGTGCATGCTCTGTTAGAGAGAACTTCCAAAGGGAAAAAAAATATTGA
GAGAGAGAGAGAGAAGAGTTTTTGGCGAGAAGGTCCCCAAGTTTCGCCATTATTACCTAC
ATTGCACTCCAATGTATGGGAGGAGACCCATCTCTAGAATTCTTGTTTTCCTTCCATTGT
TTCTTGGTTGTCTCCTCTCTTTTTTTTTTCTTTTTCTTTTTTCTTTTTCTGTTCCAGTTT
GTGAGACTAACCCCCTTTTTCCCCCTTCACATTTCCCTTTACCTT

CDS

825 bp

>Os02t0516400-01 WW domain protein, Regulation of cuticle development
ATGACTGCCCCGAACATCGAGATGATCGCCTCGTCGCTGCGCAACTGCTCCCTCAACGGC
GGGGGAGGAGGAGGAGGAGGGCGGCGCAGGGGGAGGCGCGCGGCGGCGGCGGAGGGGAGC
GACGACAGCGAGGGGGTCACCGTCGAGCTCAACTCCGAGGTCGCCCTGCCCTACCACTGG
GAGCAGTGCCTCGACATCCGGACGGGGCAAGTTTACTACATCAACTGGGAGGACGGCACC
CGGACGACCATCGATCCGCGCTCGTCGTCGGCGTACTCGCCGTCGCCGGCGTCGCGGTCC
GCGTCGTCCTCCTCCCGCCGCTGCTCGCGCGCGCGGGGCCGCGGCGGCGGAGGCGGCGCC
GCCGCCGCGGCGTCGACCACCACGTCGTCGGGGTACACCTCCGTGTCGTCCGTGGGCGCG
GTCACCGCGGCGGCGGCGGCGTGGCGCTCGCACGACAGCAGCGGGCACGGCTACGGCTAC
GGCTACGGCTACGGCAGCTATGGCTACGGCTACGGCTACGACGGCCGCGACGGCGACGAC
GAGGAGAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCAGCGCCAGCAGCAGC
CGGGGCTCCGCCGTGTCGTCCACGCTCTCGTCGTTCTCCCCCACCGACGAGTCGGCCTCC
GGCGCCGGCAGCGGCTACGCCGTCGGCGACAACGGCGCCCACGTCCTCGTCGCCGCCGGC
TGCCGGGCTTGCTTCATGTACTTCATGGTGCCGAAGACCGCCGACGTGTGCCCCAAGTGC
GGCAGCTCCGGCCTCCTCCACCTCAGCCGCAACGGCTACGTCTGA

Protein

275 aa

>Os02t0516400-01 WW domain protein, Regulation of cuticle development
MTAPNIEMIASSLRNCSLNGGGGGGGGRRRGRRAAAAEGSDDSEGVTVELNSEVALPYHW
EQCLDIRTGQVYYINWEDGTRTTIDPRSSSAYSPSPASRSASSSSRRCSRARGRGGGGGA
AAAASTTTSSGYTSVSSVGAVTAAAAAWRSHDSSGHGYGYGYGYGSYGYGYGYDGRDGDD
EESSSSSSSSSSSSSSASSSRGSAVSSTLSSFSPTDESASGAGSGYAVGDNGAHVLVAAG
CRACFMYFMVPKTADVCPKCGSSGLLHLSRNGYV*

CDS

chr02:18641688..18641888 (- strand) : 201 bp

chr02:18639496..18640119 (- strand) : 624 bp

3'UTR

chr02:18639136..18639495 (- strand) : 360 bp

FASTA

>Os02t0516400-01 class=Sequence position=chr02:18639136..18641888 (- strand)
ATGACTGCCC CGAACATCGA GATGATCGCC TCGTCGCTGC GCAACTGCTC CCTCAACGGC GGGGGAGGAG GAGGAGGAGG
GCGGCGCAGG GGGAGGCGCG CGGCGGCGGC GGAGGGGAGC GACGACAGCG AGGGGGTCAC CGTCGAGCTC AACTCCGAGG
TCGCCCTGCC CTACCACTGG GAGCAGTGCC TCGACATCCG GGTACGTCTA CTACTACTCG CCCATCTCTT CTTCCACACA
TGCATCCATA CATGCATACG CCGCGTTTCC TTTTCTTCCC CGATCGATTC TTGCGGCGGC GGCGGCGGTG GGCGGCGGCG
CGCCGCCCTT TGTCCAATCA TTTGGAGACA TAAATGGATA GCAGTTTCCG AGGTAGGTGG GTGTGGTTTG GTTTGGGCTC
GATTGGGATC AATCATTTGA TCATTAATGG CGAAAGCGGG CGCTCGAACT GGAGAGAGAG ACGAGACGAG ACGACCCGTC
CGCGCTGATT TTTTTTTTCT TCTTCCTCCT CTTCTCTTTC TGCTCCTCGT CTCCCTTCTC TCTTCTTGTT CTTGTTCTTG
GATCCTTGCT TCATCTGCGA TTCCTCTCTT CGTCTATGCA AATATTTTTT TTATTTATCT CTGTTTTTTT TCTTCGGTTC
TTATCTTCGT TTGGTTGGGG ATTCGATCAT CTTCAGAGAG ATTCAGGCCG TTCTTTTTAA CACAGGGATG ACAAAAGTTC
AGAAAAGAAA CCTCGGAAAA GATGGTACTA TTTTTTTCTT TTTTTTTGTT GATGATATCA AGGCTCTTCA AATCTCCACA
CCTTCTCTGG TCTCTGATCT AAGCGCGCAT TCAGATCTGT GTTGCATTCT AAATTTCTGA CACATCCCTG TAGATCCATT
CCTTTTTGCT CTGTCTCTAT CTGAAACTCT AGATTTCGCT ATAGATTTCT TCTGGACCAC AATGCTCTGT TTTTTTGGTC
CTGGGTTCTA ATCTAATCGC AGAGCTTTGT TAAACACCAG ATGATTCTCA CCTCTGGGAA ATCTTCAGTT CCATTGTGAC
AAAGTGTCTC CCTTTCTTTT TCATCCCTGC TAGTACTTTG AACAGACGAA TGAATGCCTA CCCCAATGAA GATTCATGCG
TATTAATCAC CAAAATGGAG TGTTCATCTC CACCTTGTCT CCAGCAACAG AGTAGACAAA AATGCTCTTC TTATGGTTAT
TTCAGTAGCC TTTTCTGAAG ATACTACTGC AATACATTTA TGTGCTTTTT AAGTAGAACA GCTTTCCTGC AGATTAGAGT
TTTTTTTTTT TTACAAAGGA TGAAATGAGA ATTTGGTGGT GGTGTTCTTC ATTGCCAACC TTGCCCTGTG ATTTGCAAAC
AAACAAGAGG ACAAAGAGAG CAGCATTCAT TACACCATTT GATCCAGATT TTTTTTCTTT CCCCTGTTCT GCTGTACTTT
GTTATGGGCA TCAGTTATTA ATAGGTTCTC AACCTTGTTT CACGGAAGCA ACTGAATGCC ACCGCATTAA TTGTTCTTGC
AGACTGTCAC CAAAATGTAC TTGTAGATTT TCCCCACCCA AACTTCTCCA TGCATCATGC ACATTTACTC ACCACATTCT
TGAAACAGCA TTTCGCCATT TGCAAGATTA ACTTAATCTG TACCACTAGC TGTCTAGTTC AAGCGCATTT CCTTTATTGT
TATTATTTTT AGATGAATTT TGATGTGTAG TTCATGACTT CATGTGAATT TGTGTGAAAT GTGCTTTGTG ATTGGCTTTG
CTGATGCAGA CGGGGCAAGT TTACTACATC AACTGGGAGG ACGGCACCCG GACGACCATC GATCCGCGCT CGTCGTCGGC
GTACTCGCCG TCGCCGGCGT CGCGGTCCGC GTCGTCCTCC TCCCGCCGCT GCTCGCGCGC GCGGGGCCGC GGCGGCGGAG
GCGGCGCCGC CGCCGCGGCG TCGACCACCA CGTCGTCGGG GTACACCTCC GTGTCGTCCG TGGGCGCGGT CACCGCGGCG
GCGGCGGCGT GGCGCTCGCA CGACAGCAGC GGGCACGGCT ACGGCTACGG CTACGGCTAC GGCAGCTATG GCTACGGCTA
CGGCTACGAC GGCCGCGACG GCGACGACGA GGAGAGCAGC AGCAGCAGTA GCAGCAGCAG CAGCAGCAGC AGCAGCGCCA
GCAGCAGCCG GGGCTCCGCC GTGTCGTCCA CGCTCTCGTC GTTCTCCCCC ACCGACGAGT CGGCCTCCGG CGCCGGCAGC
GGCTACGCCG TCGGCGACAA CGGCGCCCAC GTCCTCGTCG CCGCCGGCTG CCGGGCTTGC TTCATGTACT TCATGGTGCC
GAAGACCGCC GACGTGTGCC CCAAGTGCGG CAGCTCCGGC CTCCTCCACC TCAGCCGCAA CGGCTACGTC TGAGCCTCCG
CCGCCGCCGC CGTCCCCGCG CCGCCGCTCG CCGCCGCCGA GTTCCGCAAT TCACTAATTG TAGGGGGGCC TTCTCGCAAT
TGTGCATGCT CTGTTAGAGA GAACTTCCAA AGGGAAAAAA AATATTGAGA GAGAGAGAGA GAAGAGTTTT TGGCGAGAAG
GTCCCCAAGT TTCGCCATTA TTACCTACAT TGCACTCCAA TGTATGGGAG GAGACCCATC TCTAGAATTC TTGTTTTCCT
TCCATTGTTT CTTGGTTGTC TCCTCTCTTT TTTTTTTCTT TTTCTTTTTT CTTTTTCTGT TCCAGTTTGT GAGACTAACC
CCCTTTTTCC CCCTTCACAT TTCCCTTTAC CTT

Locus: Os02g0516400

Loading...

Locus: Os02g0516400

Loading...