Os02t0527600-01

Locus

Os02g0527600

Description

Functional homolog of Arabidopsis Raf-like protein CONSTITUTIVE TRIPLE RESPONSE1 (CTR1), Ethylene-receptor signalling

RAP-DB Gene Symbol Synonym(s)

OsCTR2

RAP-DB Gene Name Synonym(s)

CONSTITUTIVE TRIPLE-RESPONSE2

CGSNL Gene Symbol

CTR2

CGSNL Gene Name

CONSTITUTIVE TRIPLE-RESPONSE 2

Oryzabase Gene Symbol Synonym(s)

OsCTR2

Oryzabase Gene Name Synonym(s)

CONSTITUTIVE TRIPLE-RESPONSE2

Transcript Evidence

AK288723

Protein Evidence

A0A0P0VJX9

Literature

PMID: 24006427

Note

Manual Curation

March 23, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase, catalytic domain (IPR001245)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Full-length cDNA

J090063A13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0527600-01)

Others

Oryzabase (14991)

KEGG (Os02t0527600-01)

Transcript

4240 bp

>Os02t0527600-01 Functional homolog of Arabidopsis Raf-like protein CONSTITUTIVE TRIPLE RESPONSE1 (CTR1), Ethylene-receptor signalling
GGCCATGCCGTCCGTCTCGACAACTCCGTCCGCGAAGGAATCCCCACCCACGCGGCCACG
CCCACGCCCACGCCTCGATCGCCTCTCCCGCACATGCGACTTCAGCGCAACTCCGCCACC
GCCACGACGCAGCAGCGCGGGTAGACGATGAAGGCCGACGCCAAGTGGCCCGCGATGGTG
CTCGGCGGCGGCGGCGGCGGCGGGAGGCGTGCCTCGCCAGGGTCTGCGCCTCCGCCCGCC
GCGCCCGCTGCCGTGGCGTACAGCCTCCTCGCCACCTCCCCGCCCGCCAGCATCGGCAAC
GGTGGCGGCTCGCCGCACTGCGACGACGGCGACGCGTCCCGCGGGCTCGGCGTGGCGGAC
TGGCTGCGGCTGCAGCGGCACTCGAGCGGGAGCAGCGCCGGCGACGACGGGGATGGCTTC
TCCTCCGTCTCCACCCTCGCCACTGCCGACAAGGGCGGCGACCCCGCCGATCGCCCGGCC
GGCAGCAGCGGCGGCGGCGGCAGCAAGAGCTGGGCGCAGCAGGcggaggaggcgtaccag
ctccagctcgccctcgcgctccgtctctgctccgaggcctccaccgcccccgaccccaac
ttcctcgactccgccgtggcggcggccgacgaccaccaccgcgACGCGCCCTCGCCCCAA
TCCCTCTCGCATCGCTTCTGGGTGAATGGCAGCTTGTCCTACTCCGACAAGGTCCTGGAT
GGCTTCTACCTCATTCATGGGATGGATCCCTTCGTATGGACGCTCTGCAATGACTTGCGC
GATGGCGCCCGAGTGCCCTCGATCGAGTCGCTCAAGGCTATGAATCCCACCGAGTCATCC
GTGGAGGTGGTCCTCATAGATAGGGTGGTCGACTATGATCTGAGGCAACTGATAAGCACG
GCGATTGACGTTTCTCGGAGCCGCGCTGACTCAAGGGAAATCACCACTCGCCTTGCTGGC
ATTGTGTCCTCAAAGATGGGGGGTTCCGTAGCATCTACCGAAGAACATGAACTGTGTCCC
CGGTGGAGAGACTCTGCCGGGTTCCTGAAGATTAGTTCAGGTTCTGTTGTGCTTCCAATT
GGGAAGTTATCAATCGGTCTTTGCCGGCACCGATCGTTGCTGTTTAAGACCTTAGCAGAC
ACTATCAGTCTCCCATGTCGAGTTGTGAGGGGATGCAGGTACTGCAAATCTGCTGGTGCT
GCTTCATGCCTGGTGCACTTTGGTAATGACAGGGAATATCTGATTGATTTGATAGGGAAC
CCAGGCTTCTTATCTGAACCTGACTCCCTCTTAAATGGGCTCTCATCCATTTCAGTTTCT
TCACCATTGCGCCCACCAAAATACAATTCAGCTGATATTGTTAATAACTTCAAGTCATTG
GCGAAGCAATATTTCCTTGATTGCCAATCGCTAAATATGATGTTCAATGATCCAGCAGCA
GGGACGGTTGTTGACTTAGATGAGGCCATGGGATCAAATATTGGTCCAAACTTATCGCCT
GCAACAAACAGTGATTTTCAAGCTAACTTTTCACATCGTAGTCGTGGTGCCCAGTCCAGT
GGTCAAGATGGCAATTTTCTTATTCAGAAGAGTTCTCCTGAGGATACACAATCTGCACAA
AGTGACCCCTTCAGTGATATATCTCTCGACATTGAAGACTTGATTATTCCTTGGAGTGAA
CTTGTTTTGAAAGAGAAAATTGGAGCTGGCTCATTTGGAACCGTGCACCGTGCGGATTGG
AATGGCTCGGATGTTGCTGTAAAGATTTTGATGGAGCAAGACTTCCACCCAGAGCGTCTC
AAAGAATTTCTTAGGGAGGTTGCAATTATGAAAAGTCTGCGCCATCCAAACATTGTCCTT
TTTATGGGTGCTGTTACTCAGCCACCAAAACTTTCGATTGTGACAGAATATCTATCAAGA
GGTAGCCTATACAGGATTTTGCACAAGCATGGTGCAAGGGAAAATCTAGATGAGAAGCGG
CGATTGAGTATGGCTTTTGACGTGGCTAAGGGGATGAATTACCTTCACAAGCGCAATCCT
CCTATAGTCCACCGGGATCTAAAGTCACCAAATCTGTTGGTTGATAAAAAGTACACTGTG
AAGGTCTGTGACTTTGGTCTCTCCAGATTGAAGGCAAACACATTTTTGTCTTCCAAGACT
GCAGCAGGGACTCCTGAGTGGATGGCACCAGAAGTTATACGAGATGAGCCATCAAATGAG
AAGTCTGATGTCTACAGCTTTGGTGTTATCCTATGGGAGCTCATGACATTGCAACAACCA
TGGAGTACTTTGAATCCAGCTCAGGTTGTAGCAGCTGTTGGTTTTAATGGGCGAAGGCTT
GAAATTCCAAGTAGCGTTGATCCAAAAGTGGCGGCAATAATGGAATCCTGCTGGACAAAA
GAACCCTGGCGACGACCGTCTTTTGCCAGTATCATGGAATCCCTGAAACCTCTAATCAGA
ACTCCCCATCAACTTCAAGAGGATATCAGTTAACGGTTCATGGGTACCTTCAAAACCCTG
AAGATACGAGCCCTTGACAACTTACAAAGGTGACTAGCTATCTTAGTCGTTAACTTCTTA
GGTTTGAATTCAGACATTTTTCTTTCTTTTGGCTTCCGATTATTGTCAGTAATATTTTTG
CTCCGAAAGCTATTTAAGCTTATAGTTATATCTCTTCCCTGGACGGCTAAATTAGTTATT
TCACTGGTAAAGTTCATTTTCATGATAATGTATATATTCATACCATGCTATACCGTACAT
ACAAAATGAACAGACTCCTTAAATAAAGCCCATCATTTTTTTTTTTGCCTCAGTTAATGC
TTTTAGGTGTATTGTTCATGCATGCTGTTGCTAGTATGATTGCTTGTGAAATTCCATTGC
ATTGTCTTTGGTCCCTAGCACTGTCTAAATTGTCCTTGAGAAGAAAAGGACTGTGTGTCT
GTGTATGTAAAGATGTTTATGGAAATGTTCGATACAATATCCCCAAAATCAAAACCTTTT
CACAACATATTTTATCTTTGGATTTAATCCATCTATCTTTTGTTCAAAAATCCTTTTAGC
CTCTTTTTTGTTTTAATTATACGGTAGACACACGCGCGCACACACCACTACATACACAAT
GCAACACCAATGCAACACTTACATTCCGAATGCATCCTCGTACATATGCTCTAAGAGACT
GAAACCAACGGTACATCTCCATTGAAAGCTCACTTGCATGTTTGTAATATTTGTGGGCAC
TAGGATTTAAACCCATCGTACCACTAGCCTCTTTAAAACATGGAATTCTAAAAAAAATAA
TACATTAGTAAAACACTGGATTAGTGTGTCATTTATTGTTCAATCCTCAGTAATTCTATA
ACATTTGGAATTATTACATCATGCTGCTTGGATGCTCGCCATTAGAAAAATACAGTACTT
TTAGGAGAAAGGCGCGATGGAGAACTTCTACGTACCTGGTCATATCTCATGTTGGAGATC
CTCAAAAGCTGTTACCACTTACCATCACGCGCACAATCACAAAGCATTCCCTTACCATAA
CTCACACTAAAAGTTTTTCAAAAACAGCCAGTCTATTTTCAAATTACTCTCCCTTGGTCC
AAAAAAAATGAATTTTTTTAGTGTACCTTTAAATAAATATGGACCGTAGAAGATATGAGA
TCTAAGGGTGGAAATTCGTTGTTACTACACCTAGTATAAGGGTGTAGTAGTGTAGTACAA
GGGTGACTGTGGAAAAATTATAGATGGGGTGTATTATGTAATTGCGCGTGCACTGCAATA
GGGCCGGCTCAATTGATTCTACGTCCCGATTTGGGATTAGTTGATTAATTAACATATACC
CGAGGAAAAAAAGGGCTGCAGATCCTCGTGGCTGTGGCGTTGGTCGTCGTGGATGGTTGC
AGATCGTGCTGGATGTGGTGCATGCAGTGGAGGTCTCGACTGGCGGCGGCGACCAGATCG
GCGTTCGCCTGTGGTTGACGGCGGAGGTGGAGATTAATCATCACCTGGGCTGTCAATAAG
ATGGGCCTCCCAAAGCACTGGGCCAGATGTACGTACTTGGACTCAAACTCCTAAATGGGC
TCCACTGATCCAGCCGATAATACATGGACTCAAAATAAAATTGGACAAGCATCTTATCCT
CGCATGTTCGGACCGGCTGGTTCCTCGCATGTTTGTAATCCAGACATAACATAATTTGTT
CTAAAATGGTAGTTCTAGTTTAATTTATGTGATCACAACG

CDS

2346 bp

>Os02t0527600-01 Functional homolog of Arabidopsis Raf-like protein CONSTITUTIVE TRIPLE RESPONSE1 (CTR1), Ethylene-receptor signalling
ATGAAGGCCGACGCCAAGTGGCCCGCGATGGTGCTCGGCGGCGGCGGCGGCGGCGGGAGG
CGTGCCTCGCCAGGGTCTGCGCCTCCGCCCGCCGCGCCCGCTGCCGTGGCGTACAGCCTC
CTCGCCACCTCCCCGCCCGCCAGCATCGGCAACGGTGGCGGCTCGCCGCACTGCGACGAC
GGCGACGCGTCCCGCGGGCTCGGCGTGGCGGACTGGCTGCGGCTGCAGCGGCACTCGAGC
GGGAGCAGCGCCGGCGACGACGGGGATGGCTTCTCCTCCGTCTCCACCCTCGCCACTGCC
GACAAGGGCGGCGACCCCGCCGATCGCCCGGCCGGCAGCAGCGGCGGCGGCGGCAGCAAG
AGCTGGGCGCAGCAGGcggaggaggcgtaccagctccagctcgccctcgcgctccgtctc
tgctccgaggcctccaccgcccccgaccccaacttcctcgactccgccgtggcggcggcc
gacgaccaccaccgcgACGCGCCCTCGCCCCAATCCCTCTCGCATCGCTTCTGGGTGAAT
GGCAGCTTGTCCTACTCCGACAAGGTCCTGGATGGCTTCTACCTCATTCATGGGATGGAT
CCCTTCGTATGGACGCTCTGCAATGACTTGCGCGATGGCGCCCGAGTGCCCTCGATCGAG
TCGCTCAAGGCTATGAATCCCACCGAGTCATCCGTGGAGGTGGTCCTCATAGATAGGGTG
GTCGACTATGATCTGAGGCAACTGATAAGCACGGCGATTGACGTTTCTCGGAGCCGCGCT
GACTCAAGGGAAATCACCACTCGCCTTGCTGGCATTGTGTCCTCAAAGATGGGGGGTTCC
GTAGCATCTACCGAAGAACATGAACTGTGTCCCCGGTGGAGAGACTCTGCCGGGTTCCTG
AAGATTAGTTCAGGTTCTGTTGTGCTTCCAATTGGGAAGTTATCAATCGGTCTTTGCCGG
CACCGATCGTTGCTGTTTAAGACCTTAGCAGACACTATCAGTCTCCCATGTCGAGTTGTG
AGGGGATGCAGGTACTGCAAATCTGCTGGTGCTGCTTCATGCCTGGTGCACTTTGGTAAT
GACAGGGAATATCTGATTGATTTGATAGGGAACCCAGGCTTCTTATCTGAACCTGACTCC
CTCTTAAATGGGCTCTCATCCATTTCAGTTTCTTCACCATTGCGCCCACCAAAATACAAT
TCAGCTGATATTGTTAATAACTTCAAGTCATTGGCGAAGCAATATTTCCTTGATTGCCAA
TCGCTAAATATGATGTTCAATGATCCAGCAGCAGGGACGGTTGTTGACTTAGATGAGGCC
ATGGGATCAAATATTGGTCCAAACTTATCGCCTGCAACAAACAGTGATTTTCAAGCTAAC
TTTTCACATCGTAGTCGTGGTGCCCAGTCCAGTGGTCAAGATGGCAATTTTCTTATTCAG
AAGAGTTCTCCTGAGGATACACAATCTGCACAAAGTGACCCCTTCAGTGATATATCTCTC
GACATTGAAGACTTGATTATTCCTTGGAGTGAACTTGTTTTGAAAGAGAAAATTGGAGCT
GGCTCATTTGGAACCGTGCACCGTGCGGATTGGAATGGCTCGGATGTTGCTGTAAAGATT
TTGATGGAGCAAGACTTCCACCCAGAGCGTCTCAAAGAATTTCTTAGGGAGGTTGCAATT
ATGAAAAGTCTGCGCCATCCAAACATTGTCCTTTTTATGGGTGCTGTTACTCAGCCACCA
AAACTTTCGATTGTGACAGAATATCTATCAAGAGGTAGCCTATACAGGATTTTGCACAAG
CATGGTGCAAGGGAAAATCTAGATGAGAAGCGGCGATTGAGTATGGCTTTTGACGTGGCT
AAGGGGATGAATTACCTTCACAAGCGCAATCCTCCTATAGTCCACCGGGATCTAAAGTCA
CCAAATCTGTTGGTTGATAAAAAGTACACTGTGAAGGTCTGTGACTTTGGTCTCTCCAGA
TTGAAGGCAAACACATTTTTGTCTTCCAAGACTGCAGCAGGGACTCCTGAGTGGATGGCA
CCAGAAGTTATACGAGATGAGCCATCAAATGAGAAGTCTGATGTCTACAGCTTTGGTGTT
ATCCTATGGGAGCTCATGACATTGCAACAACCATGGAGTACTTTGAATCCAGCTCAGGTT
GTAGCAGCTGTTGGTTTTAATGGGCGAAGGCTTGAAATTCCAAGTAGCGTTGATCCAAAA
GTGGCGGCAATAATGGAATCCTGCTGGACAAAAGAACCCTGGCGACGACCGTCTTTTGCC
AGTATCATGGAATCCCTGAAACCTCTAATCAGAACTCCCCATCAACTTCAAGAGGATATC
AGTTAA

Protein

782 aa

>Os02t0527600-01 Functional homolog of Arabidopsis Raf-like protein CONSTITUTIVE TRIPLE RESPONSE1 (CTR1), Ethylene-receptor signalling
MKADAKWPAMVLGGGGGGGRRASPGSAPPPAAPAAVAYSLLATSPPASIGNGGGSPHCDD
GDASRGLGVADWLRLQRHSSGSSAGDDGDGFSSVSTLATADKGGDPADRPAGSSGGGGSK
SWAQQAEEAYQLQLALALRLCSEASTAPDPNFLDSAVAAADDHHRDAPSPQSLSHRFWVN
GSLSYSDKVLDGFYLIHGMDPFVWTLCNDLRDGARVPSIESLKAMNPTESSVEVVLIDRV
VDYDLRQLISTAIDVSRSRADSREITTRLAGIVSSKMGGSVASTEEHELCPRWRDSAGFL
KISSGSVVLPIGKLSIGLCRHRSLLFKTLADTISLPCRVVRGCRYCKSAGAASCLVHFGN
DREYLIDLIGNPGFLSEPDSLLNGLSSISVSSPLRPPKYNSADIVNNFKSLAKQYFLDCQ
SLNMMFNDPAAGTVVDLDEAMGSNIGPNLSPATNSDFQANFSHRSRGAQSSGQDGNFLIQ
KSSPEDTQSAQSDPFSDISLDIEDLIIPWSELVLKEKIGAGSFGTVHRADWNGSDVAVKI
LMEQDFHPERLKEFLREVAIMKSLRHPNIVLFMGAVTQPPKLSIVTEYLSRGSLYRILHK
HGARENLDEKRRLSMAFDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSR
LKANTFLSSKTAAGTPEWMAPEVIRDEPSNEKSDVYSFGVILWELMTLQQPWSTLNPAQV
VAAVGFNGRRLEIPSSVDPKVAAIMESCWTKEPWRRPSFASIMESLKPLIRTPHQLQEDI
S*

5'UTR

chr02:19331984..19332130 (- strand) : 147 bp

CDS

chr02:19331450..19331983 (- strand) : 534 bp

chr02:19331069..19331367 (- strand) : 299 bp

chr02:19330840..19330987 (- strand) : 148 bp

chr02:19330417..19330520 (- strand) : 104 bp

chr02:19329872..19330080 (- strand) : 209 bp

chr02:19329152..19329302 (- strand) : 151 bp

chr02:19328949..19329064 (- strand) : 116 bp

chr02:19328241..19328281 (- strand) : 41 bp

chr02:19327900..19327968 (- strand) : 69 bp

chr02:19327496..19327596 (- strand) : 101 bp

chr02:19327308..19327392 (- strand) : 85 bp

chr02:19327059..19327157 (- strand) : 99 bp

chr02:19326543..19326611 (- strand) : 69 bp

chr02:19326324..19326455 (- strand) : 132 bp

chr02:19326142..19326236 (- strand) : 95 bp

chr02:19325966..19326059 (- strand) : 94 bp

3'UTR

chr02:19324219..19325965 (- strand) : 1747 bp

FASTA

>Os02t0527600-01 class=Sequence position=chr02:19324219..19332130 (- strand)
GGCCATGCCG TCCGTCTCGA CAACTCCGTC CGCGAAGGAA TCCCCACCCA CGCGGCCACG CCCACGCCCA CGCCTCGATC
GCCTCTCCCG CACATGCGAC TTCAGCGCAA CTCCGCCACC GCCACGACGC AGCAGCGCGG GTAGACGATG AAGGCCGACG
CCAAGTGGCC CGCGATGGTG CTCGGCGGCG GCGGCGGCGG CGGGAGGCGT GCCTCGCCAG GGTCTGCGCC TCCGCCCGCC
GCGCCCGCTG CCGTGGCGTA CAGCCTCCTC GCCACCTCCC CGCCCGCCAG CATCGGCAAC GGTGGCGGCT CGCCGCACTG
CGACGACGGC GACGCGTCCC GCGGGCTCGG CGTGGCGGAC TGGCTGCGGC TGCAGCGGCA CTCGAGCGGG AGCAGCGCCG
GCGACGACGG GGATGGCTTC TCCTCCGTCT CCACCCTCGC CACTGCCGAC AAGGGCGGCG ACCCCGCCGA TCGCCCGGCC
GGCAGCAGCG GCGGCGGCGG CAGCAAGAGC TGGGCGCAGC AGGcggagga ggcgtaccag ctccagctcg ccctcgcgct
ccgtctctgc tccgaggcct ccaccgcccc cgaccccaac ttcctcgact ccgccgtggc ggcggccgac gaccaccacc
gcgACGCGCC CTCGCCCCAA TCCCTCTCGC ATCGCTTCTG GGTTCGCACT CACCGCGCGC ACACACCAGT TCACCGAAAG
ATGTATACCG ATTCTCCAAG TGACCATCTC GCTGTCTTGG CAGGTGAATG GCAGCTTGTC CTACTCCGAC AAGGTCCTGG
ATGGCTTCTA CCTCATTCAT GGGATGGATC CCTTCGTATG GACGCTCTGC AATGACTTGC GCGATGGCGC CCGAGTGCCC
TCGATCGAGT CGCTCAAGGC TATGAATCCC ACCGAGTCAT CCGTGGAGGT GGTCCTCATA GATAGGGTGG TCGACTATGA
TCTGAGGCAA CTGATAAGCA CGGCGATTGA CGTTTCTCGG AGCCGCGCTG ACTCAAGGGA AATCACCACT CGCCTTGCTG
GCATTGTGTC CTCAAAGATG GGGTGAGAGA CTGGGAGTTG ATAAGGAAAT TGCCACTTTT GGTACATTTT CTCTGTCTTA
CATGTGTCTC ACTAATGTTG AAGGGGTTCC GTAGCATCTA CCGAAGAACA TGAACTGTGT CCCCGGTGGA GAGACTCTGC
CGGGTTCCTG AAGATTAGTT CAGGTTCTGT TGTGCTTCCA ATTGGGAAGT TATCAATCGG TCTTTGCCGG CACCGATCGT
TGCTGTTTAA GGTCACCTTG CTTCTATCGC TATGTTCTAA AATCTATTAA ATCTTCGTAT TTAGTGGCAA TATTTTCCAT
GTTAGCGCTG GAACTTTGTT TTTATGATTT TACAAAGCTC ATCATGCAAT ATTCCTGATT GCCCTAAAAT ACATTAGATG
GTGAATTATA GTGATATTGA TGCACTCACA AGCATACATA GGAGCTGCAC TACTTTAAAA GATCAGTTTC TTATGATCCT
ATTTCATTTT AGTTGCCAGT CCTGATACTC TCTTGTCTCT TCAATTTGTT TTTGATAATA ATCCTATTCT GTTTTCTTTG
GTGGGGAAAG ACCTTAGCAG ACACTATCAG TCTCCCATGT CGAGTTGTGA GGGGATGCAG GTACTGCAAA TCTGCTGGTG
CTGCTTCATG CCTGGTGCAC TTTGGTAATG ACAGGTTTGT AATCCTGATG AATGACTTGC ACTATTTCTA CAGATTTTGG
GTCATCAAAG GTTAAAAAAG AGAGAGAATA TGAAGAAAGA ATTGTGCCCC AGTTACACCA ATTACATTCC TTGTCTGATC
TAACAATGTC ATAGAAAGAG GGTATAACAT TGTTATAAAT GTGAAAATGG AAAAAATATA AATGGAACTT ATGTTCTCAA
GTTATCTGTA CAATCTTGCT CCGAATATTC TTTATTTTTC CAGTTTTCTA TGTTCTTTTA CACTCTCCAG TTTTCAATGT
TGAAATAGCA TCTAATCACT TCTTGACTTC TATTTTATTT TTGGTATCAG GGAATATCTG ATTGATTTGA TAGGGAACCC
AGGCTTCTTA TCTGAACCTG ACTCCCTCTT AAATGGGCTC TCATCCATTT CAGTTTCTTC ACCATTGCGC CCACCAAAAT
ACAATTCAGC TGATATTGTT AATAACTTCA AGTCATTGGC GAAGCAATAT TTCCTTGATT GCCAATCGCT AAATATGATG
TTCAATGATC CAGCAGCAGG TCAGATCATA CTTTTCTGTC TTCTAAATAC TATTTATTTA AGTACTCTTC ACATGATGTG
ATATTAATAG TAATATCTCA AATGGGCTGA TCTGTATAGG AAGAGATTTT GACATTATTA AACTTTTAAA ATTAACAGCT
GATGCTGCTG TGAGCATGTT GTGTTCTATG TTCAAATAGA TAGTTTTTAG ATTTTTTTTT GCTGGGAGAA ACTTTATGTC
ATTGACATCT AGTTTTGATA TAGGCAACAA TCTTTCAGCA CAATCATTTT AGATGTTAAA ACTTAAAACT TTTTTGGATG
AAATAGTATG GTTTACAATA GTTCTTAGCT GTAGTTTCAC AATTCAGGTC TAGTCATTTT CTCCTGAATG GTCTTCAAAA
GTTTTAAAAG AAAAGATGGA AAATGAACTG CCTACTATTC TAAGCAAGCA AACTGAGTAA CTGACCAATT GATATTTTTT
ATCATCACTA TTTCAATTCT TGAATTGGAA TTTCAGAAAG CAGGACTAAA AAAAATATTT AAGATCTTTT CAAAAGATTG
TGTCTTTTAC TATTTTGAAT AGTTTCAGGG ACGGTTGTTG ACTTAGATGA GGCCATGGGA TCAAATATTG GTCCAAACTT
ATCGCCTGCA ACAAACAGTG ATTTTCAAGC TAACTTTTCA CATCGTAGTC GTGGTGCCCA GTCCAGTGGT CAAGATGGCA
ATTTTCTTAT TCAGAAGAGG TGCATCAGCA GGATCCTCCC TAAAAATTGT TATAGTTATT TCCACTTTCC ATCATCCAAA
GTTGATAATA CTGATGAATA TTTCAGTTCT CCTGAGGATA CACAATCTGC ACAAAGTGAC CCCTTCAGTG ATATATCTCT
CGACATTGAA GACTTGATTA TTCCTTGGAG TGAACTTGTT TTGAAAGAGA AAATTGGAGC TGGTACGTTT TTGTTTTTTA
ATAGTGTTTT TGTACGATGT ACTTAGTTTT TTTTATCTCT ATTATACTAC ACATGACCTC CAATCAACAA AACGAATTGT
TCTGGCTTAG CTTTTTTTTT TAAAAAAAAA AAAAATCTCT ATACCACATA CAACCTCCAA TCAATAAAGC AAGTTGTTCT
GGCTTACATG AGCAAGTACA ATGAAGAGTG ACATTGGGCA TTCTTTTGTA TCATTTAGCC TCTTCTAACC CTACTAATTA
CATAAGCATG TTATTAATGA AAGTTAACCA CAACGTTTAG TGTGAGACTA CAAAGAATAT TTGCAATTAA CTCCATGGAT
TATAGTACCA ATGCATGATA TTAAATAGGG CCAATCTTGT ACAAAACCAC AAATTACTGA AAGTTCGGTA TGCGCATCCA
AGGCACAAGG CTAGAACTAG GTGCCTTCTT CACTAGAGTT TTACCACAGT TATGCACAAG GCTAGAACAA GGCGCAAGGC
AAATTAATAG CATGCAGTTT TTATTTTACA CATATTTTGC GAAGGTGAAC AAGTTGAATA TTTTGGACAT CCGTGACCTC
ACATTGTGAA AATTAATGAA TGATCATGAA GCTGCCTATT TCCAGATTTT GATATTTTTG TAGTGTGCAC TAATTGAGAA
AAATGACAGG CTCATTTGGA ACCGTGCACC GTGCGGATTG GAATGGCTCG GTATGTCTCT TTTTATTACA AGCACATTTT
ACAGTGTGCT TATGTGTTAC AAGTTACTAC TTGAATAGTG ACCGGTCTAA CATGTACTGC ATACAACTAC GCCTCCTGTA
TTTCCTTTTT GGTGTGCCAA TATATGATTT TAGGAGAGAT GTTAACAAAT GTTGTTTCAA TAACCTGAAA CACTCAACCG
TCCCACAGTT ATGTACTTAT TCTTCATGTG AGGAATTGAG GATAGGAGAG CTCAATTAAC ACTCTTGCCT TTCATGTCTC
AGGATGTTGC TGTAAAGATT TTGATGGAGC AAGACTTCCA CCCAGAGCGT CTCAAAGAAT TTCTTAGGGA GGTATAACAT
CAGAATTTCC AGTGGACAAT TTATATTGGT CTTCCTTTGC GACTACCAAA TCTGATAGGG ATGAAAGCAG CAGCGCTTTG
AATTTTCCTA CATATAATGG ACATGTTATA CAACGATGTG CATGACTAGA TGCTTCTGAA CTGATCTTTC CTCTGCAACA
AAGTTAATGC CCAGTATTCT TTCTTTTTTT AACAGAGAAT GTTAAGATGT TGCCCCATTC AAGGTCACAT GTATAAGTTG
ATTTAATCAT GTAATGTCCA TGTCACTTAA CATGTTAGGT ATTCTCCTCT GTAGGTTGCA ATTATGAAAA GTCTGCGCCA
TCCAAACATT GTCCTTTTTA TGGGTGCTGT TACTCAGCCA CCAAAACTTT CGATTGTGAC AGAATATCTA TCAAGGTGTG
TTGAACTTTC TGATTACTAT TTCAAAATTG ATGTAAACTA TGTGCTTACC TCTAGTCTAG CTTGTAGTTC CCACATAAGT
TTTTTTTCTT GAATGCAGAG GTAGCCTATA CAGGATTTTG CACAAGCATG GTGCAAGGGA AAATCTAGAT GAGAAGCGGC
GATTGAGTAT GGCTTTTGAC GTGGTAAAAT CATATATACT TATCTCAATA CAGAATTTAG GTCTAACAGA ATGACTGGAC
ATATGCTTTA TATAAAGTAA AGGTTGACCG TAGAATCAAA ATTGTAGGTG CTTCTTTATA AAAATCATTG ATTTTGTGTA
CCTTCGTATC CAGGCTAAGG GGATGAATTA CCTTCACAAG CGCAATCCTC CTATAGTCCA CCGGGATCTA AAGTCACCAA
ATCTGTTGGT TGATAAAAAG TACACTGTGA AGGTATATCC TTTTACCCAT TTTGCCATAT TTTAAGACCT GTTTGATTTC
ACATTACTCT TTGTGGTACT TTTTGTTATT TTTTCTACTT TGTTTTTGGA CAAAGTATAA CTTCCGGCCT CTGCCCCATG
ACTCCGCCAC CACACCAATG GTTTTTCCCC TTTTAACCAA AGATGCACAT GGCCATATTT GTGGACACCA GAATTTGAAC
TCTAGTGGGT GGAATCATGC ACCCATGACT CCGCCACCAC ACCAATGGCG TTTCCCCTTT TATGAGAAAA CTTTATCTTC
AATTACTCTA TGTGGTACTT TATTATTATT ATTTTTTCTA CTTGAATGGG TATAGTTGTT ATGATCATTA GGATTATCTT
TCTTTCTAAT ATAATTGGCA GTTGTTCCCT ATTTAATCTT ATCTCCAACT AACAACAAAT TTCCCCTACA ATGCTGCAGG
TCTGTGACTT TGGTCTCTCC AGATTGAAGG CAAACACATT TTTGTCTTCC AAGACTGCAG CAGGGACTGT AAGTTCATAT
TACCGTTACT TTTATTTGTT GATTTTTTTT CAGCTAAATC GTGCTAGTAA GTGCTTTCGA TGTAATATTC TCTAGCCTGA
GTGGATGGCA CCAGAAGTTA TACGAGATGA GCCATCAAAT GAGAAGTCTG ATGTCTACAG CTTTGGTGTT ATCCTATGGG
AGCTCATGAC ATTGCAACAA CCATGGAGTA CTTTGAATCC AGCTCAGGTT TGTATCTCCT GTTTTCTTCA TCACACGGAT
ATTTTCCAAC TTCGGACGAA CTGAATTGAA CAAAGTCTAC CTGTTCACTT GCAGGTTGTA GCAGCTGTTG GTTTTAATGG
GCGAAGGCTT GAAATTCCAA GTAGCGTTGA TCCAAAAGTG GCGGCAATAA TGGAATCCTG CTGGACAAAG TATCTATAAT
ATACTGTTAT ATGTTTCTTC TCACAACTTG TAGCCAAGTT GGTTTGATGA ATATTTTATT TTTATTTGCA GAGAACCCTG
GCGACGACCG TCTTTTGCCA GTATCATGGA ATCCCTGAAA CCTCTAATCA GAACTCCCCA TCAACTTCAA GAGGATATCA
GTTAACGGTT CATGGGTACC TTCAAAACCC TGAAGATACG AGCCCTTGAC AACTTACAAA GGTGACTAGC TATCTTAGTC
GTTAACTTCT TAGGTTTGAA TTCAGACATT TTTCTTTCTT TTGGCTTCCG ATTATTGTCA GTAATATTTT TGCTCCGAAA
GCTATTTAAG CTTATAGTTA TATCTCTTCC CTGGACGGCT AAATTAGTTA TTTCACTGGT AAAGTTCATT TTCATGATAA
TGTATATATT CATACCATGC TATACCGTAC ATACAAAATG AACAGACTCC TTAAATAAAG CCCATCATTT TTTTTTTTGC
CTCAGTTAAT GCTTTTAGGT GTATTGTTCA TGCATGCTGT TGCTAGTATG ATTGCTTGTG AAATTCCATT GCATTGTCTT
TGGTCCCTAG CACTGTCTAA ATTGTCCTTG AGAAGAAAAG GACTGTGTGT CTGTGTATGT AAAGATGTTT ATGGAAATGT
TCGATACAAT ATCCCCAAAA TCAAAACCTT TTCACAACAT ATTTTATCTT TGGATTTAAT CCATCTATCT TTTGTTCAAA
AATCCTTTTA GCCTCTTTTT TGTTTTAATT ATACGGTAGA CACACGCGCG CACACACCAC TACATACACA ATGCAACACC
AATGCAACAC TTACATTCCG AATGCATCCT CGTACATATG CTCTAAGAGA CTGAAACCAA CGGTACATCT CCATTGAAAG
CTCACTTGCA TGTTTGTAAT ATTTGTGGGC ACTAGGATTT AAACCCATCG TACCACTAGC CTCTTTAAAA CATGGAATTC
TAAAAAAAAT AATACATTAG TAAAACACTG GATTAGTGTG TCATTTATTG TTCAATCCTC AGTAATTCTA TAACATTTGG
AATTATTACA TCATGCTGCT TGGATGCTCG CCATTAGAAA AATACAGTAC TTTTAGGAGA AAGGCGCGAT GGAGAACTTC
TACGTACCTG GTCATATCTC ATGTTGGAGA TCCTCAAAAG CTGTTACCAC TTACCATCAC GCGCACAATC ACAAAGCATT
CCCTTACCAT AACTCACACT AAAAGTTTTT CAAAAACAGC CAGTCTATTT TCAAATTACT CTCCCTTGGT CCAAAAAAAA
TGAATTTTTT TAGTGTACCT TTAAATAAAT ATGGACCGTA GAAGATATGA GATCTAAGGG TGGAAATTCG TTGTTACTAC
ACCTAGTATA AGGGTGTAGT AGTGTAGTAC AAGGGTGACT GTGGAAAAAT TATAGATGGG GTGTATTATG TAATTGCGCG
TGCACTGCAA TAGGGCCGGC TCAATTGATT CTACGTCCCG ATTTGGGATT AGTTGATTAA TTAACATATA CCCGAGGAAA
AAAAGGGCTG CAGATCCTCG TGGCTGTGGC GTTGGTCGTC GTGGATGGTT GCAGATCGTG CTGGATGTGG TGCATGCAGT
GGAGGTCTCG ACTGGCGGCG GCGACCAGAT CGGCGTTCGC CTGTGGTTGA CGGCGGAGGT GGAGATTAAT CATCACCTGG
GCTGTCAATA AGATGGGCCT CCCAAAGCAC TGGGCCAGAT GTACGTACTT GGACTCAAAC TCCTAAATGG GCTCCACTGA
TCCAGCCGAT AATACATGGA CTCAAAATAA AATTGGACAA GCATCTTATC CTCGCATGTT CGGACCGGCT GGTTCCTCGC
ATGTTTGTAA TCCAGACATA ACATAATTTG TTCTAAAATG GTAGTTCTAG TTTAATTTAT GTGATCACAA CG

Locus: Os02g0527600

Loading...

Locus: Os02g0527600

Loading...