Os02t0537500-01

Locus

Os02g0537500

Description

E2F transcription factor

RAP-DB Gene Symbol Synonym(s)

OsE2F1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Orysa;E2F1, OsE2F1, E2F1

Oryzabase Gene Name Synonym(s)

E2F transcription factor 1

Transcript Evidence

AK068689

Protein Evidence

Q5QL93

Literature

PMID: 29610335

PMID: 12060226

Note

Manual Curation

May 7, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: transcription factor complex (GO:0005667)

Functional domain (InterPro)

Winged helix-like DNA-binding domain superfamily (IPR036388)

Winged helix DNA-binding domain superfamily (IPR036390)

E2F-DP heterodimerization region (IPR037241)

E2F/DP family, winged-helix DNA-binding domain (IPR003316)

E2F transcription factor, CC-MB domain (IPR032198)

Full-length cDNA

J013161I16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0537500-01)

RiceXPro (AK068689)

Others

Oryzabase (13310)

KEGG (Os02t0537500-01)

Transcript

2348 bp

>Os02t0537500-01 E2F transcription factor
CTTCCCTCCTCTCTCTCTTCGATTCCCCTTTCCCCCCCTCACCCACCCACCTCCACGCCC
CCGCCGCCGGCCGGCCGGCCGGAACCCTAGCTCCGGCGAGCCCCTCCCACCCCCCGGCCC
CGGGCCTGGCTCCACCCGACGCCGCGCCCCTCGATCGGGTCCCTTGCGGGGGACCGCGGC
GTCGAGGAGGGCGATCGCGAGATCGGGGGAGGTTGCTGCTGCTGCTGGGCGGGTGGGCGG
AGGGGAGGGGGTGAGGGCTGCCATGGCGGGGAGTGGGAGGCCGCCGGCGGCGCAGAAGAA
GATCCTGCAGTCGCTGCGCCCGCCGCTGCCGTTCGCCGCCTCGTCGAGGTCGCCCTTCGC
GGCGCCCAACGACTACCACCGCTTCCCCGCTGGTGGCGCGGCGGCGGCGGCGGCGTCTGG
TTCGGGTGGCATCGGCGCGGGCGGTGCTGGCGGCGGCGGCGATATCGAGGAGGGGCTGGT
CATCCGGACGCCGCAAAAAAGAAAAGCACCAGAAGAAAGTGATGTTGCTGAGTCTAGCGA
CTGTATGATTACTAGCCCTGGATTTGCTGTCAGTCCAATGCTCACTCCAGTCTCTGGGAA
AGCTGTTAAGACTTCCAAGTCAAAGACTAAGAACAACAAAGCTGGGCCTCAGACACCTAC
ATCAAATGTTGGTTCACCACTTAATCCCCCAACTCCTGTTGGTACATGCCGTTATGACAG
TTCGTTAGGGCTTCTCACAAAGAAGTTCATAAATTTGCTGAAGCAGGCTCCGGATGGCAT
TCTAGATTTGAATAATGCTGCAGAAACACTAGAGGTTCAAAAACGGCGTATATATGATAT
TACCAATGTACTTGAAGGAATAGGGTTGATTGAAAAGACACTCAAGAACAGAATCCGTTG
GAAGGGCTTGGATGATTCAGGAGTGGAATTAGATAATGGTCTTTCAGCTTTGCAGGCAGA
AGTTGAAAATCTTAGTCTGAAGGAGCAAGCATTAGATGAGCGCATAAGTGATATGCGTGA
AAAACTAAGAGGTTTAACTGAAGATGAAAACAATCAAAGATGGCTCTATGTGACAGAAGA
TGATATCAAGGGATTACCCTGCTTTCAGAATGAAACACTAATTGCAATAAAAGCTCCTCA
TGGCACTACACTTGAAGTCCCAGATCCTGACGAGGCTGGTGATTATCTCCAGAGAAGATA
TAGAATCGTATTAAGAAGTACAATGGGCCCAATAGATGTCTACTTAGTTAGTCAATTTGA
TGAGAAATTTGAGGACTTGGGTGGGGGTGCAACACCATCAGGGCATGCAAATGTACCAAA
ACATCAACCTACTGAAGTCTTCAATACAACAAATGCTGGGGTTGGGCAATGTAGCAACTC
AGTTGCTGTGGACAATAATATTCAGCACAGCCAGACGATTCCTCAGGATCCTAGTGCTTC
ACATGATTTTGGAGGAATGACAAGGATTATCCCTTCAGATATTGATACTGATGCTGATTA
CTGGCTCATATCAGAAGGGGATGTCAGCATTACTGATATGTGGAAAACAGCACCAGATGT
GCAGTGGGATGAGAGCCTGGATACGGATGTCTTCCTATCTGAAGACGTTAGAACGCCAAG
TTCACACAATCAGCAGCCATCTGCAGTGGGCGGGCCACAGATGCAGGTCTCAGACATGCA
TAAACCCTAGGATCACAGGGGTTACAGAAGTGAAAAGATGACATCTGGAATTCCTGGAGC
GGTGTTTGTAGTGAAAAGTGAAAGCATGACAGCAAATGCTCATTGCCAAATTGTAAAGAG
CCGGGTGGTCTTCATCAGAATATCTGCATCTTCTCGAGACACCAAGTCCGTGCGAGAGAT
CAGGATGACACCATTCCGGATTCACATCTGCTGTGGAGGCTGGTGGCGTCAACTAACTTA
CCAGCCTGCTGTTTCAGCACCCTGCTTCAGTCGAACGGGAGTAAATCTTGCTGCTGCTTT
CGCTGTGAAGCCTGCTGCGGTGCTCATTAAGGCACTGATATATTTTTTGCATTCAAAACT
AACTAGTCATCAGCAAGGAAACGGTGGGCTTTGCTGTGCTCTGTCGAGTATTCTTTGAAA
ATTCTTTGTACATTGGGAGGTATAAGGGCATGCAGGGCTCGAGTTATTGGTTTGACGGGA
GCAATGAGCTGAGTTAATGATGTAACCGAGCCGTCTTTGTAAATTGTTCCATGCTCTTCC
TCAAATACAATGGATAGACTTTCATTTTGAGATATGATGCTTCAGTAGTCATTTGCTAGT
CACCATGGAGTGATGTGATATCTTTGCTACTGGTATGAACCTCAAAATGATACTCGCCGT
TAATTTTT

CDS

1428 bp

>Os02t0537500-01 E2F transcription factor
ATGGCGGGGAGTGGGAGGCCGCCGGCGGCGCAGAAGAAGATCCTGCAGTCGCTGCGCCCG
CCGCTGCCGTTCGCCGCCTCGTCGAGGTCGCCCTTCGCGGCGCCCAACGACTACCACCGC
TTCCCCGCTGGTGGCGCGGCGGCGGCGGCGGCGTCTGGTTCGGGTGGCATCGGCGCGGGC
GGTGCTGGCGGCGGCGGCGATATCGAGGAGGGGCTGGTCATCCGGACGCCGCAAAAAAGA
AAAGCACCAGAAGAAAGTGATGTTGCTGAGTCTAGCGACTGTATGATTACTAGCCCTGGA
TTTGCTGTCAGTCCAATGCTCACTCCAGTCTCTGGGAAAGCTGTTAAGACTTCCAAGTCA
AAGACTAAGAACAACAAAGCTGGGCCTCAGACACCTACATCAAATGTTGGTTCACCACTT
AATCCCCCAACTCCTGTTGGTACATGCCGTTATGACAGTTCGTTAGGGCTTCTCACAAAG
AAGTTCATAAATTTGCTGAAGCAGGCTCCGGATGGCATTCTAGATTTGAATAATGCTGCA
GAAACACTAGAGGTTCAAAAACGGCGTATATATGATATTACCAATGTACTTGAAGGAATA
GGGTTGATTGAAAAGACACTCAAGAACAGAATCCGTTGGAAGGGCTTGGATGATTCAGGA
GTGGAATTAGATAATGGTCTTTCAGCTTTGCAGGCAGAAGTTGAAAATCTTAGTCTGAAG
GAGCAAGCATTAGATGAGCGCATAAGTGATATGCGTGAAAAACTAAGAGGTTTAACTGAA
GATGAAAACAATCAAAGATGGCTCTATGTGACAGAAGATGATATCAAGGGATTACCCTGC
TTTCAGAATGAAACACTAATTGCAATAAAAGCTCCTCATGGCACTACACTTGAAGTCCCA
GATCCTGACGAGGCTGGTGATTATCTCCAGAGAAGATATAGAATCGTATTAAGAAGTACA
ATGGGCCCAATAGATGTCTACTTAGTTAGTCAATTTGATGAGAAATTTGAGGACTTGGGT
GGGGGTGCAACACCATCAGGGCATGCAAATGTACCAAAACATCAACCTACTGAAGTCTTC
AATACAACAAATGCTGGGGTTGGGCAATGTAGCAACTCAGTTGCTGTGGACAATAATATT
CAGCACAGCCAGACGATTCCTCAGGATCCTAGTGCTTCACATGATTTTGGAGGAATGACA
AGGATTATCCCTTCAGATATTGATACTGATGCTGATTACTGGCTCATATCAGAAGGGGAT
GTCAGCATTACTGATATGTGGAAAACAGCACCAGATGTGCAGTGGGATGAGAGCCTGGAT
ACGGATGTCTTCCTATCTGAAGACGTTAGAACGCCAAGTTCACACAATCAGCAGCCATCT
GCAGTGGGCGGGCCACAGATGCAGGTCTCAGACATGCATAAACCCTAG

Protein

476 aa

>Os02t0537500-01 E2F transcription factor
MAGSGRPPAAQKKILQSLRPPLPFAASSRSPFAAPNDYHRFPAGGAAAAAASGSGGIGAG
GAGGGGDIEEGLVIRTPQKRKAPEESDVAESSDCMITSPGFAVSPMLTPVSGKAVKTSKS
KTKNNKAGPQTPTSNVGSPLNPPTPVGTCRYDSSLGLLTKKFINLLKQAPDGILDLNNAA
ETLEVQKRRIYDITNVLEGIGLIEKTLKNRIRWKGLDDSGVELDNGLSALQAEVENLSLK
EQALDERISDMREKLRGLTEDENNQRWLYVTEDDIKGLPCFQNETLIAIKAPHGTTLEVP
DPDEAGDYLQRRYRIVLRSTMGPIDVYLVSQFDEKFEDLGGGATPSGHANVPKHQPTEVF
NTTNAGVGQCSNSVAVDNNIQHSQTIPQDPSASHDFGGMTRIIPSDIDTDADYWLISEGD
VSITDMWKTAPDVQWDESLDTDVFLSEDVRTPSSHNQQPSAVGGPQMQVSDMHKP*

5'UTR

chr02:19873046..19873307 (- strand) : 262 bp

CDS

chr02:19872815..19873045 (- strand) : 231 bp

chr02:19871348..19871525 (- strand) : 178 bp

chr02:19871209..19871265 (- strand) : 57 bp

chr02:19870914..19870999 (- strand) : 86 bp

chr02:19870732..19870820 (- strand) : 89 bp

chr02:19870579..19870630 (- strand) : 52 bp

chr02:19870405..19870457 (- strand) : 53 bp

chr02:19870257..19870307 (- strand) : 51 bp

chr02:19870123..19870171 (- strand) : 49 bp

chr02:19869956..19870021 (- strand) : 66 bp

chr02:19869785..19869861 (- strand) : 77 bp

chr02:19869473..19869707 (- strand) : 235 bp

chr02:19869113..19869179 (- strand) : 67 bp

chr02:19868858..19868994 (- strand) : 137 bp

3'UTR

chr02:19868200..19868857 (- strand) : 658 bp

FASTA

>Os02t0537500-01 class=Sequence position=chr02:19868200..19873307 (- strand)
CTTCCCTCCT CTCTCTCTTC GATTCCCCTT TCCCCCCCTC ACCCACCCAC CTCCACGCCC CCGCCGCCGG CCGGCCGGCC
GGAACCCTAG CTCCGGCGAG CCCCTCCCAC CCCCCGGCCC CGGGCCTGGC TCCACCCGAC GCCGCGCCCC TCGATCGGGT
CCCTTGCGGG GGACCGCGGC GTCGAGGAGG GCGATCGCGA GATCGGGGGA GGTTGCTGCT GCTGCTGGGC GGGTGGGCGG
AGGGGAGGGG GTGAGGGCTG CCATGGCGGG GAGTGGGAGG CCGCCGGCGG CGCAGAAGAA GATCCTGCAG TCGCTGCGCC
CGCCGCTGCC GTTCGCCGCC TCGTCGAGGT CGCCCTTCGC GGCGCCCAAC GACTACCACC GCTTCCCCGC TGGTGGCGCG
GCGGCGGCGG CGGCGTCTGG TTCGGGTGGC ATCGGCGCGG GCGGTGCTGG CGGCGGCGGC GATATCGAGG AGGGGCTGGT
CATCCGGACG CCGGTGAGCG CGCGGTTCTC GATTTACTCC GTTTCTGTTT GGAGGGCGGG GGGTTTTGGG GCGCGGGAGC
TGACGAAGCT GCTGTGGTGG TTTGAGCTCT CCTGGTGAGG ATTATGGGTC AAAATCTGCG CGTTCTATCT GTATGCATGT
GTCCGTTTCA GTGTAGCCGT CAGAACCCTG GGTAGATTTG GGTGGAATTT TGGTCAATTT CTAAGCTTCC GCTAAGTCTT
CCTAGTCTGG TCAAAGCATA ATTGCTCAGT AGCTCCAACT ATTCTTATGC TAAGTAAATG TCGACTATGA TAGACACGCG
ACGCAGATCG ATATGGAAAG AATTTGATCC ATGCAGTTGT CGGAGCCAAG GTTTGAACTC AAGGGGAAGT TTTTATGTCA
AATCATAAGT GTTGTGAAGA TAGTGATGAC TTTGTTGACC ACATACGGAA TAGATGGAAA CTCGTACGGC AGATGCTAAT
CTAGCTATTG GAACCGTGGG TAGATTCGGG CAAGAATTTT GGTCAATCTG ACAATTTCTT GGCTTCCCTC AAAGTCTTCC
AAGTTTAGCC AAGCATAAAT GCTCAGTAGC TCCAACTATT CTTATGTTAA GTGTCGACTA TGTTAGATCC GTGATGTGGA
TCGATAAAGA AAGAATTCAA GCCGTGCAGT TGTTGGCGTG TCACCCCGTG CAGGGCTTGA ACTGAAGGGG AAGTTTTTAT
GTCAGATCAT AAATGTTTCA AAGAGAAATA ATCTGTGCAG CGACTTTGTT GACCAGATAG GGAAGCAACG GAAACCTGTA
TGGCAGATGC TAATAACAGA GGCCACTTAA TCTTGCCAGA ATCGCGTGTG CTCCCGTGAC TGGCATGCTG CAGTTGTGGG
CGCTCTATCT CATTTTACAA GCTATTTTGT ATACAATATC CTTGTGTTGT GATATACTAC TATCCCACAG CTGACATCAG
ATAGTCAGGA TATACTACAG TAGCAACACC ACAGGTGTTT CTGTTTACCT TCATAATGTT TCTTAACTGT TGGCATGATT
AATATTCCAA GTTGAACTGG ATCTATGGAG TACATCGAGA CAGTCCCACT AAACCAGTAA GGATGGGAAT ATGGTGTTTG
TTTGTTCTTT ATATGTTGTC TAGCATCCAT GGATTCTGTT GTTAGGACCC ACATTGGTCA TATGCTTAAG ATGATACATT
TTTGTTCTAT GTTCTGAATT TACCAATGAT CGACATATCC CTCTTGGGAT GTTTCTCATT ACTTTTAGCG ACTATAAAAT
ACAAGCTATT CTCTCTTCAC AGCAAAAAAG AAAAGCACCA GAAGAAAGTG ATGTTGCTGA GTCTAGCGAC TGTATGATTA
CTAGCCCTGG ATTTGCTGTC AGTCCAATGC TCACTCCAGT CTCTGGGAAA GCTGTTAAGA CTTCCAAGTC AAAGACTAAG
AACAACAAAG CTGGGCCTCA GACACCTACA TCAAATGTTG GTATGTGTAA TCTTCTTTCT AGTCATTTTC TCTGTGTGTT
ATGTCGTATG AACAATTAAA CATGCATATT TTCTGTTTAC AGGTTCACCA CTTAATCCCC CAACTCCTGT TGGTACATGC
CGTTATGACA GTTCGTTAGG TGATAATGTC ACTCTCTGCC TACAATTGTT TTTTTCTTTT TCAAGTCTTA GTCTGAGACA
TTGCAATCCA ACTTCTATCA TATATAAGTA AAGTCTGGGA AGCTTATATA CATTTTGTAT TTTGTTACAA TTTATCTTGC
CTTTTCGGCT TTTCATATTA CTGTGTTGTT ACTTGTTACT TATATTTGTC CTTGCAATTC ATGTCCAGGG CTTCTCACAA
AGAAGTTCAT AAATTTGCTG AAGCAGGCTC CGGATGGCAT TCTAGATTTG AATAATGCTG CAGAAACACT AGAGGTCACA
GACTGTTATA AACTATAATA CTATATCATT TCATCTGACA TCTCTTTTCT CTCACTTTAT ACACAATTCA CATTTTCCTA
TTTTCAGGTT CAAAAACGGC GTATATATGA TATTACCAAT GTACTTGAAG GAATAGGGTT GATTGAAAAG ACACTCAAGA
ACAGAATCCG TTGGAAGTAA GCACTTTTAT TCCTTTAACC CTTATCTTCC TTTATTGCCA CCTGATCTTA TTTCTTTAAC
CCTTAAATTG TCATTCTAAT CTCACACAAC ATTTCAGGGG CTTGGATGAT TCAGGAGTGG AATTAGATAA TGGTCTTTCA
GCTTTGCAGG TATTTGGTCA TGTACAGTTT AAATTGGCGT ACTATCTTAA GTGCACCAGA ATACCTTTAT TCTGACAAGA
ATGCCTGTGC ATATTTCTAA GCACAAATCC ATATGCAACC CTTTCTGCAG GCAGAAGTTG AAAATCTTAG TCTGAAGGAG
CAAGCATTAG ATGAGCGCAT AAGGTTAGTA GCTGTCTGTG GTTTCACATG GACCACAATT TTCTATGCTA CAGAACCTAA
CAAGAACATG GCTTAATCGA AGAGCTTGTG TTCTATGCAG TGATATGCGT GAAAAACTAA GAGGTTTAAC TGAAGATGAA
AACAATCAAA GGTATTTCTT ATTTAATTTC ATCAATAGTG TGAGGGAGTC ATCATCGTGT TTACTAATGT ACAGCATCTA
TTTCATTTTT ACATAGATGG CTCTATGTGA CAGAAGATGA TATCAAGGGA TTACCCTGCT TTCAGGTTTT CTATTCTACT
TACATGCCAT AACAAGGCCA CCTTGTTGTA GATTATCATT TGATTAACAC ATGTATTATA GGTAACATAT TTTTTTCATT
CTGCAGAATG AAACACTAAT TGCAATAAAA GCTCCTCATG GCACTACACT TGAAGTCCCA GATCCTGACG AGGTAGGAAG
CAGTTAAAAT TAAGGGACTC TGTATGTGAC AATAAATGGC ATCGTGAAAC TGGTTCACAG CTTCTTGTAA TATACTCCCT
ATGCAGGCTG GTGATTATCT CCAGAGAAGA TATAGAATCG TATTAAGAAG TACAATGGGC CCAATAGATG TCTACTTAGT
TAGGTAATGG TGCATTCCTC TGTTGATGTT AAATACATGA ATTGATTTTC ACCTGATCAA AACCTTACCA TTTTATTTAG
TCAATTTGAT GAGAAATTTG AGGACTTGGG TGGGGGTGCA ACACCATCAG GGCATGCAAA TGTACCAAAA CATCAACCTA
CTGAAGTCTT CAATACAACA AATGCTGGGG TTGGGCAATG TAGCAACTCA GTTGCTGTGG ACAATAATAT TCAGCACAGC
CAGACGATTC CTCAGGATCC TAGTGCTTCA CATGATTTTG GAGGAATGAC AAGGATTATC CCTTCAGATA TTGATGTAAG
TCAGATCCTC TTTAATTTTG ATTTTCCTTC CAGAATAGCA TAATTTATAG TTGTAAAGTT ATAGCTAGAC ATTACGGCAT
GGTACATGCA TCTTTGAACT TTTGCTTTAC TTCTCTAGTG TTTTTTAGCA ATTCAAACAT GCAAATCCTT CATGTGTAGA
AACTATTATA TATTATTGTG TTCATAACCG CTCTGTCATA AGTTGTCCTT TGCCCGAGAA CCTCTTATGT CAAAAAAGAC
CTAAATATAT CATATCATAC TTATGGTCCT TTTTACACTA TTTTGCAGAC TGATGCTGAT TACTGGCTCA TATCAGAAGG
GGATGTCAGC ATTACTGATA TGTGGAAAAC AGCACGTATC CTTTATGATC GTTCATTACA CTTTTGTTTG GACTATTCAT
AGTTTTGTTT AGAAGTCATT TGTAACTTAT AAGTAGCTAC TGTTGCAACT TGAAGTACTT AACATGGAAA CAGCAGATGT
GCAGTGGGAT GAGAGCCTGG ATACGGATGT CTTCCTATCT GAAGACGTTA GAACGCCAAG TTCACACAAT CAGCAGCCAT
CTGCAGTGGG CGGGCCACAG ATGCAGGTCT CAGACATGCA TAAACCCTAG GATCACAGGG GTTACAGAAG TGAAAAGATG
ACATCTGGAA TTCCTGGAGC GGTGTTTGTA GTGAAAAGTG AAAGCATGAC AGCAAATGCT CATTGCCAAA TTGTAAAGAG
CCGGGTGGTC TTCATCAGAA TATCTGCATC TTCTCGAGAC ACCAAGTCCG TGCGAGAGAT CAGGATGACA CCATTCCGGA
TTCACATCTG CTGTGGAGGC TGGTGGCGTC AACTAACTTA CCAGCCTGCT GTTTCAGCAC CCTGCTTCAG TCGAACGGGA
GTAAATCTTG CTGCTGCTTT CGCTGTGAAG CCTGCTGCGG TGCTCATTAA GGCACTGATA TATTTTTTGC ATTCAAAACT
AACTAGTCAT CAGCAAGGAA ACGGTGGGCT TTGCTGTGCT CTGTCGAGTA TTCTTTGAAA ATTCTTTGTA CATTGGGAGG
TATAAGGGCA TGCAGGGCTC GAGTTATTGG TTTGACGGGA GCAATGAGCT GAGTTAATGA TGTAACCGAG CCGTCTTTGT
AAATTGTTCC ATGCTCTTCC TCAAATACAA TGGATAGACT TTCATTTTGA GATATGATGC TTCAGTAGTC ATTTGCTAGT
CACCATGGAG TGATGTGATA TCTTTGCTAC TGGTATGAAC CTCAAAATGA TACTCGCCGT TAATTTTT