Os02t0538000-01

Locus

Os02g0538000

Description

Threonyl-tRNA synthetase, Chloroplast biogenesis and chloroplast ribosomal system construction

RAP-DB Gene Symbol Synonym(s)

LAS

RAP-DB Gene Name Synonym(s)

Lethal albinic seedling

CGSNL Gene Symbol

LAS

CGSNL Gene Name

LETHAL ALBINIC SEEDLING

Oryzabase Gene Symbol Synonym(s)

OsLAS

Oryzabase Gene Name Synonym(s)

Lethal albinic seedling

Transcript Evidence

AK058738

Protein Evidence

Q6ER90

Literature

PMID: 28405745

Note

Manual Curation

April 18, 2017

Gene Ontology (GO)

Biological Process: tRNA aminoacylation for protein translation (GO:0006418)

Biological Process: threonyl-tRNA aminoacylation (GO:0006435)

Biological Process: tRNA aminoacylation (GO:0043039)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: aminoacyl-tRNA ligase activity (GO:0004812)

Molecular Function: threonine-tRNA ligase activity (GO:0004829)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ligase activity, forming aminoacyl-tRNA and related compounds (GO:0016876)

Cellular Component: cytoplasm (GO:0005737)

Functional domain (InterPro)

Threonine-tRNA ligase, class IIa (IPR002320)

Threonyl/alanyl tRNA synthetase, class II-like, putative editing domain (IPR018163)

Threonyl/alanyl tRNA synthetase, SAD (IPR012947)

Aminoacyl-tRNA synthetase, class II (IPR006195)

Aminoacyl-tRNA synthetase, class II (G/ P/ S/T) (IPR002314)

Threonine-tRNA ligase catalytic core domain (IPR033728)

Anticodon-binding (IPR004154)

Full-length cDNA

001-019-G05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0538000-01)

RiceXPro (AK058738)

Others

Oryzabase (22608)

KEGG (Os02t0538000-01 (EC:6.1.1.3))

Transcript

2269 bp

>Os02t0538000-01 Threonyl-tRNA synthetase, Chloroplast biogenesis and chloroplast ribosomal system construction
GCAGAGAGACCAAAAACGATATCCAACAGCAGCGGCCACCAcgcgcccaccgctcccggc
gcgcgccacaatggcggccgccgtctccgcgccccttctccggttccaccaccaccaccg
ctgcctcctccgccactcctcctcgccgcgccgctacccagccggcttctcgcgtgggct
cagctccgtctcgttcggcctcccgcgcagcaccaccaccgccgcgcgctccaccgcctc
gccctcggcgccgtcggcggcgGCGGCCGAGGCCACGGATGCGGCTTCCGCCCAGGCGGG
ATCCGACGGCAAGGGGGATGGGATTGGGGAGGAGGAGCGCGTCGTGCTCCCCACCAACGA
GTCCTCCGACCGCCTGCTCCGCATCCGCCACACCTGTGCGCATGTGATGGCCATGGCCGT
CCAGAAGCTGTTCCCCAACTCCAAGGTGACAATAGGTCCCTGGATAGACAACGGCTTCTA
CTACGACTTCGACATGGAGCCCCTCACGGACAAGGACCTCAAGAGGATCAAGAAAGAGAT
GGATCGGATCATCCGGAAGAATCTCCCATTGGTGAGGGAGGAGGTGTCCAGGGAAGAGGC
CCAAAAGAGGATTGAAGCGCTTAATGAGCCATATAAGTTGGAAATTTTGGAGGGCATCAA
GGAAGATCCTATCACAATCTATCACATTGGAGAAGAGTGGTGGGATCTCTGTGCCGGACC
TCATGTCGAGTCTACTGGCAAAATCGATAGAAGAGCTGTTGAGCTTGAGTCTGTTGCTGG
TGCTTACTGGAGAGGTGACGAAAGTAATCAAATGCTACAAAGAATATACGGGACTGCATG
GGAGACTGAAGACCAATTGAAGGCTTACATCCACTTCAAGGAAGAGGCCAAGCGCCGTGA
TCATCGGCGATTAGGTCTGGATCTTGATCTATTCTCCATACAGGAAGATGCTGGTGGCGG
TTTAGTATTCTGGCATCCAAAAGGTGCTATTATCAGACATGTTTTAGAAGACTCATGGAA
ACAGATTCACTTGCAACGTGGTTATGATCTATTATACACTCCCCACGTTGCAAAGGCTGA
ACTTTGGAAGGTTAGTGGGCATATCGATTTCTACAAAGAGAACATGTACAATCAAATGGA
TGTTGAAGATGAGCTATATCAACTTCGGCCCATGAATTGCCCTTACCACATTTTAGTATA
CAAGAGAAAGCTACATTCATACAGGGATTTTCCCATTCGAGTGGCAGAGCTTGGAACTGT
CTACAGATATGAGCTATCTGGTAGTTTGCATGGGCTGTTCCGTGTCAGAGGATTTACGCA
GGATGATGCCCACATATTTTGTCTGGAGGACCAGATAAAAGATGAAATTAGAGGTGTTCT
TGATCTGACTGAGCAAATACTGGGCCAATTTGGCTTTCGGTATTATGAGATAAACCTTTC
AACAAGGCCAGAAAAATCTGTTGGCAGTGATGACATATGGGAAAAAGCAACACTTGCACT
AAAAGATGCACTAGAAGACAAAGGTTGGGAGTACAAGGTTGATGAAGGTGGAGGCGCTTT
CTATGGCCCAAAAATTGATTTGAAAATTGAGGATGCTCTTGGAAGAAAATGGCAATGTTC
CACTGTGCAGGTCGATTTCAATTTACCTGAGCGGTTTGACATTACTTATGTCAATTCAAA
TAGCGAGAAGAAACGGCCTATCATGATTCATAGAGCTATCCTTGGGTCTTTGGAACGATT
TTTTGGTGTCCTCATTGAACACTATGCTGGTGATTTTCCACTTTGGCTTGCACCAATCCA
AGCTCGTATTCTACCTGTGACAGACAATGAGCTGCAATACTGTAACGAGGTGGCTTCAGA
ACTGAAATCAAAAGGCATTCGAGCTGAGGTATGTCATGGCGAGCGTCTACCAAAGCTAAT
ACGGAATGCCGAAACGAAGAAAGTGCCGCTCATGGCGGTCGTTGGGCCTAAAGAAGTTCA
AGCCAGGACCCTCACTATCAGGTCCAGGCATAGTGGGGAGATTGGTACTATGCCTGTGGA
TGAATTCTTTCGCAGAATCCAACTTGCTATTGCGAACAAATCTTCTTCACTATGAACATT
TAAATATGCTAAAGAGCAGTTGATATTGTAGAGTATTAGATCTTGTGCACATACACGATA
TAGCAGCTGTGCTCTAGAAGAAGTTAGCAACTGAGGTCTGGAAGAGCAGATCAAATAATT
TTGTGCATAATCGCCATCGCCGTGTTTTGCAATATAACAAATGTCCAGT

CDS

2025 bp

>Os02t0538000-01 Threonyl-tRNA synthetase, Chloroplast biogenesis and chloroplast ribosomal system construction
atggcggccgccgtctccgcgccccttctccggttccaccaccaccaccgctgcctcctc
cgccactcctcctcgccgcgccgctacccagccggcttctcgcgtgggctcagctccgtc
tcgttcggcctcccgcgcagcaccaccaccgccgcgcgctccaccgcctcgccctcggcg
ccgtcggcggcgGCGGCCGAGGCCACGGATGCGGCTTCCGCCCAGGCGGGATCCGACGGC
AAGGGGGATGGGATTGGGGAGGAGGAGCGCGTCGTGCTCCCCACCAACGAGTCCTCCGAC
CGCCTGCTCCGCATCCGCCACACCTGTGCGCATGTGATGGCCATGGCCGTCCAGAAGCTG
TTCCCCAACTCCAAGGTGACAATAGGTCCCTGGATAGACAACGGCTTCTACTACGACTTC
GACATGGAGCCCCTCACGGACAAGGACCTCAAGAGGATCAAGAAAGAGATGGATCGGATC
ATCCGGAAGAATCTCCCATTGGTGAGGGAGGAGGTGTCCAGGGAAGAGGCCCAAAAGAGG
ATTGAAGCGCTTAATGAGCCATATAAGTTGGAAATTTTGGAGGGCATCAAGGAAGATCCT
ATCACAATCTATCACATTGGAGAAGAGTGGTGGGATCTCTGTGCCGGACCTCATGTCGAG
TCTACTGGCAAAATCGATAGAAGAGCTGTTGAGCTTGAGTCTGTTGCTGGTGCTTACTGG
AGAGGTGACGAAAGTAATCAAATGCTACAAAGAATATACGGGACTGCATGGGAGACTGAA
GACCAATTGAAGGCTTACATCCACTTCAAGGAAGAGGCCAAGCGCCGTGATCATCGGCGA
TTAGGTCTGGATCTTGATCTATTCTCCATACAGGAAGATGCTGGTGGCGGTTTAGTATTC
TGGCATCCAAAAGGTGCTATTATCAGACATGTTTTAGAAGACTCATGGAAACAGATTCAC
TTGCAACGTGGTTATGATCTATTATACACTCCCCACGTTGCAAAGGCTGAACTTTGGAAG
GTTAGTGGGCATATCGATTTCTACAAAGAGAACATGTACAATCAAATGGATGTTGAAGAT
GAGCTATATCAACTTCGGCCCATGAATTGCCCTTACCACATTTTAGTATACAAGAGAAAG
CTACATTCATACAGGGATTTTCCCATTCGAGTGGCAGAGCTTGGAACTGTCTACAGATAT
GAGCTATCTGGTAGTTTGCATGGGCTGTTCCGTGTCAGAGGATTTACGCAGGATGATGCC
CACATATTTTGTCTGGAGGACCAGATAAAAGATGAAATTAGAGGTGTTCTTGATCTGACT
GAGCAAATACTGGGCCAATTTGGCTTTCGGTATTATGAGATAAACCTTTCAACAAGGCCA
GAAAAATCTGTTGGCAGTGATGACATATGGGAAAAAGCAACACTTGCACTAAAAGATGCA
CTAGAAGACAAAGGTTGGGAGTACAAGGTTGATGAAGGTGGAGGCGCTTTCTATGGCCCA
AAAATTGATTTGAAAATTGAGGATGCTCTTGGAAGAAAATGGCAATGTTCCACTGTGCAG
GTCGATTTCAATTTACCTGAGCGGTTTGACATTACTTATGTCAATTCAAATAGCGAGAAG
AAACGGCCTATCATGATTCATAGAGCTATCCTTGGGTCTTTGGAACGATTTTTTGGTGTC
CTCATTGAACACTATGCTGGTGATTTTCCACTTTGGCTTGCACCAATCCAAGCTCGTATT
CTACCTGTGACAGACAATGAGCTGCAATACTGTAACGAGGTGGCTTCAGAACTGAAATCA
AAAGGCATTCGAGCTGAGGTATGTCATGGCGAGCGTCTACCAAAGCTAATACGGAATGCC
GAAACGAAGAAAGTGCCGCTCATGGCGGTCGTTGGGCCTAAAGAAGTTCAAGCCAGGACC
CTCACTATCAGGTCCAGGCATAGTGGGGAGATTGGTACTATGCCTGTGGATGAATTCTTT
CGCAGAATCCAACTTGCTATTGCGAACAAATCTTCTTCACTATGA

Protein

675 aa

>Os02t0538000-01 Threonyl-tRNA synthetase, Chloroplast biogenesis and chloroplast ribosomal system construction
MAAAVSAPLLRFHHHHRCLLRHSSSPRRYPAGFSRGLSSVSFGLPRSTTTAARSTASPSA
PSAAAAEATDAASAQAGSDGKGDGIGEEERVVLPTNESSDRLLRIRHTCAHVMAMAVQKL
FPNSKVTIGPWIDNGFYYDFDMEPLTDKDLKRIKKEMDRIIRKNLPLVREEVSREEAQKR
IEALNEPYKLEILEGIKEDPITIYHIGEEWWDLCAGPHVESTGKIDRRAVELESVAGAYW
RGDESNQMLQRIYGTAWETEDQLKAYIHFKEEAKRRDHRRLGLDLDLFSIQEDAGGGLVF
WHPKGAIIRHVLEDSWKQIHLQRGYDLLYTPHVAKAELWKVSGHIDFYKENMYNQMDVED
ELYQLRPMNCPYHILVYKRKLHSYRDFPIRVAELGTVYRYELSGSLHGLFRVRGFTQDDA
HIFCLEDQIKDEIRGVLDLTEQILGQFGFRYYEINLSTRPEKSVGSDDIWEKATLALKDA
LEDKGWEYKVDEGGGAFYGPKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVNSNSEK
KRPIMIHRAILGSLERFFGVLIEHYAGDFPLWLAPIQARILPVTDNELQYCNEVASELKS
KGIRAEVCHGERLPKLIRNAETKKVPLMAVVGPKEVQARTLTIRSRHSGEIGTMPVDEFF
RRIQLAIANKSSSL*

5'UTR

chr02:19928271..19928340 (- strand) : 70 bp

CDS

chr02:19927947..19928270 (- strand) : 324 bp

chr02:19927658..19927804 (- strand) : 147 bp

chr02:19927397..19927544 (- strand) : 148 bp

chr02:19927031..19927284 (- strand) : 254 bp

chr02:19926085..19926462 (- strand) : 378 bp

chr02:19925408..19925716 (- strand) : 309 bp

chr02:19925140..19925340 (- strand) : 201 bp

chr02:19924594..19924857 (- strand) : 264 bp

3'UTR

chr02:19924420..19924593 (- strand) : 174 bp

FASTA

>Os02t0538000-01 class=Sequence position=chr02:19924420..19928340 (- strand)
GCAGAGAGAC CAAAAACGAT ATCCAACAGC AGCGGCCACC Acgcgcccac cgctcccggc gcgcgccaca atggcggccg
ccgtctccgc gccccttctc cggttccacc accaccaccg ctgcctcctc cgccactcct cctcgccgcg ccgctaccca
gccggcttct cgcgtgggct cagctccgtc tcgttcggcc tcccgcgcag caccaccacc gccgcgcgct ccaccgcctc
gccctcggcg ccgtcggcgg cgGCGGCCGA GGCCACGGAT GCGGCTTCCG CCCAGGCGGG ATCCGACGGC AAGGGGGATG
GGATTGGGGA GGAGGAGCGC GTCGTGCTCC CCACCAACGA GTCCTCCGAC CGCCTGCTCC GCATCCGCCA CACCGTACTT
GCTTTTTGCT GCCTCCCATT CCTCACTTCT CTACCTGTCA TTAATCTGGT TTATTCCAAT TTCGTGTTGA TTTCGCTAAC
CAATTATGCT GCTATGTCGT TGGTTGATTC GCGTCATCCT TTGCTTGCTG CTCTAGTGTG CGCATGTGAT GGCCATGGCC
GTCCAGAAGC TGTTCCCCAA CTCCAAGGTG ACAATAGGTC CCTGGATAGA CAACGGCTTC TACTACGACT TCGACATGGA
GCCCCTCACG GACAAGGACC TCAAGAGGAT CAAGAAAGAG ATGGTATGTA TGTAACCGAA TTGATTGATG TGTTCCTTTT
TTGTAATTCT CTGAACGAAC GAACTAAATT GTTGGGGTGA ATTTTTGAGT TGCTTAACAT GCTATGGTGG TGGTAGGATC
GGATCATCCG GAAGAATCTC CCATTGGTGA GGGAGGAGGT GTCCAGGGAA GAGGCCCAAA AGAGGATTGA AGCGCTTAAT
GAGCCATATA AGTTGGAAAT TTTGGAGGGC ATCAAGGAAG ATCCTATCAC AATCTATCAC ATTGGTTTGT AGTGCCATCT
CGTTTGATTT TGAGCATTAC ATTTTCGTCA TGCATTTTTT TTTTGGTTGA TCGGTGGAGT CTATGCTCAT GTTGGTGAAT
TCACTGTATA CTGTAGGAGA AGAGTGGTGG GATCTCTGTG CCGGACCTCA TGTCGAGTCT ACTGGCAAAA TCGATAGAAG
AGCTGTTGAG CTTGAGTCTG TTGCTGGTGC TTACTGGAGA GGTGACGAAA GTAATCAAAT GCTACAAAGA ATATACGGGA
CTGCATGGGA GACTGAAGAC CAATTGAAGG CTTACATCCA CTTCAAGGAA GAGGCCAAGC GCCGTGATCA TCGGCGATTA
GGTCTGGATC TTGATCTATT CTCCATACAG GTATAATCTT AATTCTGCAA CTAATTAACT CGAGAACCAT ATGGCGGTAA
TTTGTTAGTA ACGGCAAGTC TCAACCTTCA TATCCAACAT ATATTATCTT GTTGATCTTT TTCCCCCTCC ATGATATTGG
TTATATAATT TTAGCATTAC AGTGTGCCAT AGCCTCTTTG TATGGTTAGA GTGTGCAAGT CAGTCAGTCC TTTCTTCTTT
AATGCAATAG CCATATTTTG ATATAGCATC TCAAAGTAAT GGAGTTGACT CCCAAGTATT AGAATGCCTT GTTAGTTGTT
AGTTTGTTAC ACTACCAGAT ATGACTGTTA AAAACTTAAA GTGGCACCTT CATTCAAATC ATAGAACTTC ATTTTGCTGT
TAGTCTGCTA CCACCAACAT CTGCTGATGC TTCACACGTA TTTGCTATAG ACCACCAATT ATGGCACAGT ATCATCCATG
TTCCATTGGC TTAGCTTTAC AACCCTATGC CACTTTAATT CAGGCCTGAT TACATGCATA TCCAACTTTT TTTTTTACTT
TTTATTTATA GTAACTGTAG AATATGAATT TTTAACAGGA AGATGCTGGT GGCGGTTTAG TATTCTGGCA TCCAAAAGGT
GCTATTATCA GACATGTTTT AGAAGACTCA TGGAAACAGA TTCACTTGCA ACGTGGTTAT GATCTATTAT ACACTCCCCA
CGTTGCAAAG GCTGAACTTT GGAAGGTTAG TGGGCATATC GATTTCTACA AAGAGAACAT GTACAATCAA ATGGATGTTG
AAGATGAGCT ATATCAACTT CGGCCCATGA ATTGCCCTTA CCACATTTTA GTATACAAGA GAAAGCTACA TTCATACAGG
GATTTTCCCA TTCGAGTGGC AGAGCTTGGA ACTGTCTACA GATATGAGCT ATCTGGTAGT TTGCATGGGC TGTTCCGTGT
CAGAGGATTT ACGCAGGTGC CTCTCTACTT CAGAATTCTG CTTCTATTTT CTTTCTGATG GAATCATGCT GGTTCTATGC
ATTCTGCAGT CACTGAATTC AAATATATAT TGTACATTGT GATTTGTGTC ATTATGGCAT GTTTTTCTAG TGAGTTTTCC
TATGTATTGT ACTAACAGAT TTCATTAAGT ACTACtacta cctccgtttc aggttataag actttctagc attgtccaca
ttcatataga tgttaatgaa tatgctaaca tctatatgaa tgtggacaat actagaaagt cttataacct gaaacggagg
aagTACTACC TTTTGATTTC ATAACCTTTC TTGTTATTGT TATAAAATAG GTCTATTTGT GCAGGATGAT GCCCACATAT
TTTGTCTGGA GGACCAGATA AAAGATGAAA TTAGAGGTGT TCTTGATCTG ACTGAGCAAA TACTGGGCCA ATTTGGCTTT
CGGTATTATG AGATAAACCT TTCAACAAGG CCAGAAAAAT CTGTTGGCAG TGATGACATA TGGGAAAAAG CAACACTTGC
ACTAAAAGAT GCACTAGAAG ACAAAGGTTG GGAGTACAAG GTTGATGAAG GTGGAGGCGC TTTCTATGGC CCAAAAATTG
ATTTGAAAAT TGAGGATGCT CTTGGAAGAA AATGGCAATG TTCCACTGTG CAGGTCAGTT GTATATTTAT CGAAAATCTT
TGAGCACAAT GGACCACGTT AACAGTTTAC TACATTACAG GTCGATTTCA ATTTACCTGA GCGGTTTGAC ATTACTTATG
TCAATTCAAA TAGCGAGAAG AAACGGCCTA TCATGATTCA TAGAGCTATC CTTGGGTCTT TGGAACGATT TTTTGGTGTC
CTCATTGAAC ACTATGCTGG TGATTTTCCA CTTTGGCTTG CACCAATCCA AGCTCGTATT CTACCTGTGA CAGACAATGA
GGTTTGCTTC ATTTACTTTG ATCATCTAGA TGCATGACTA CATGTGCTAT TAAATTAAAA GCACCCAACT TCAGTTCGTA
ACAGCATCAT TTATCTGAAC AACCGAAGTC AGGACATCAG TGTTCTTTTG CATCTGTGGA TCCTGGTTGA TTTTATTAGT
GTAGATTAAA TCTGTTTAAG ACTTCAACCT AGCATCTTTT TTGTACTTTT ACTTTTGGCT CCATTCAGGA GATATTTCCA
GGTATTTGAT GTAAACCAGC TGCATCTTGT TTCACATTTG CAGCTGCAAT ACTGTAACGA GGTGGCTTCA GAACTGAAAT
CAAAAGGCAT TCGAGCTGAG GTATGTCATG GCGAGCGTCT ACCAAAGCTA ATACGGAATG CCGAAACGAA GAAAGTGCCG
CTCATGGCGG TCGTTGGGCC TAAAGAAGTT CAAGCCAGGA CCCTCACTAT CAGGTCCAGG CATAGTGGGG AGATTGGTAC
TATGCCTGTG GATGAATTCT TTCGCAGAAT CCAACTTGCT ATTGCGAACA AATCTTCTTC ACTATGAACA TTTAAATATG
CTAAAGAGCA GTTGATATTG TAGAGTATTA GATCTTGTGC ACATACACGA TATAGCAGCT GTGCTCTAGA AGAAGTTAGC
AACTGAGGTC TGGAAGAGCA GATCAAATAA TTTTGTGCAT AATCGCCATC GCCGTGTTTT GCAATATAAC AAATGTCCAG
T

Locus: Os02g0538000

Loading...

Locus: Os02g0538000

Loading...