Os02t0543000-01

Locus

Os02g0543000

Description

Abscisic stress ripening protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ASR1

CGSNL Gene Name

ABSCISIC ACID-STRESS-RIPENING-INDUCIBLE 1 PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsAsr1, OsASR3, ASR3, Asr3

Oryzabase Gene Name Synonym(s)

Abiotic Stress Responsive 3, "ABA-, stress and ripening-induced protein 3", "abscisic acid-, stress- and ripening (ASR) gene 3"

Transcript Evidence

AK066415 (DDBJ, Best hit)

Protein Evidence

A3A7S9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to stress (GO:0006950)

Functional domain (InterPro)

ABA/WDS induced protein (IPR003496)

Full-length cDNA

J013066K05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0543000-01)

RiceXPro (AK066415)

Others

Oryzabase (8404)

KEGG (Os02t0543000-01)

Transcript

766 bp

>Os02t0543000-01 Abscisic stress ripening protein 1.
GAGGGTTCATAGTTCATACCTGCAACAACAACTGCGCGTAACACATACCACACGCCCAAG
TACGCCCTCCCCCTCTAAACTGAGATTTGAGGCCCAAACTAATGTTATTAGCAAGTAGCT
GATGCTAGCCGCTCCTTGCTATAAATACATGTGCTTTGCTAGTTAGCTTTTGCACAGATC
AACACCGGCAACCGACTAACTCTGTCTGAAGGAAGCTAAGATTATTAATCAGTGAGTAGC
TAGCCATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGACGGGGAGG
AGGAGAGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCACCTCGAGC
AGCTCGGCGGCCTCGGCGCCATCGCCGCCGGCGCCTACGCTCTCCACGAGAAGCACCAGG
CGAAGAAGGACACGGAGAACGCGCACGGGCACAAGGTGAAGGAGGAGGTGGCGGCGGTGG
CCGCGCTGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAGA
AGCACGCCGCCGACCAATACTAGATCGATCCCGATCGAATGAACGCAAGAACGAACGGTT
TATATGCTTAATTACTTTCTCCCCATAATTACATGTATGCATGTGGTTGATGGCTTAATT
TGCTTCTTCTTGTTCGTCGTCATACGTCGTCGCTTTTACTTCGTGTTCATGTACATTAAT
TCTGTATCCGCACTGAGTATTAAATAAGTGCGTTTGTGCTGCACAC

CDS

318 bp

>Os02t0543000-01 Abscisic stress ripening protein 1.
ATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGACGGGGAGGAGGAG
AGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCACCTCGAGCAGCTC
GGCGGCCTCGGCGCCATCGCCGCCGGCGCCTACGCTCTCCACGAGAAGCACCAGGCGAAG
AAGGACACGGAGAACGCGCACGGGCACAAGGTGAAGGAGGAGGTGGCGGCGGTGGCCGCG
CTGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAGAAGCAC
GCCGCCGACCAATACTAG

Protein

106 aa

>Os02t0543000-01 Abscisic stress ripening protein 1.
MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEQLGGLGAIAAGAYALHEKHQAK
KDTENAHGHKVKEEVAAVAALGAAGFAFHEHHEKKDAKKHAADQY*

5'UTR

chr02:20166405..20166649 (- strand) : 245 bp

CDS

chr02:20166246..20166404 (- strand) : 159 bp

chr02:20165869..20166027 (- strand) : 159 bp

3'UTR

chr02:20165666..20165868 (- strand) : 203 bp

FASTA

>Os02t0543000-01 class=Sequence position=chr02:20165666..20166649 (- strand)
GAGGGTTCAT AGTTCATACC TGCAACAACA ACTGCGCGTA ACACATACCA CACGCCCAAG TACGCCCTCC CCCTCTAAAC
TGAGATTTGA GGCCCAAACT AATGTTATTA GCAAGTAGCT GATGCTAGCC GCTCCTTGCT ATAAATACAT GTGCTTTGCT
AGTTAGCTTT TGCACAGATC AACACCGGCA ACCGACTAAC TCTGTCTGAA GGAAGCTAAG ATTATTAATC AGTGAGTAGC
TAGCCATGGC TGAGGAGAAG AAGCACCACC ACCTGTTCCA CCACAAGAAG GACGGGGAGG AGGAGAGCTC CGGCGTGGTG
GACTACGACA AGGAGAAGAA GCACCACAAG CACCTCGAGC AGCTCGGCGG CCTCGGCGCC ATCGCCGCCG GCGCCTACGC
TCTCGTAAGT CATTAATTAG TACATTTGAC CACCACTATT ACAAGAAAAT CGATTTTCGC AGACGTATAT GTCATCCCCC
ACTTTAACTA ACCTATATGT TTTAGCCGCT TGGAAAAATC GATTATGTAG TGGTGAACTA TGATCTAATG ATAACTACCT
AGCCATAGCT GATTAATTAA GAGATAATTA ACGGAGAATT TATTTGTGGT ACGTCGTTGC AGCACGAGAA GCACCAGGCG
AAGAAGGACA CGGAGAACGC GCACGGGCAC AAGGTGAAGG AGGAGGTGGC GGCGGTGGCC GCGCTGGGCG CCGCGGGGTT
CGCCTTCCAC GAGCACCACG AGAAGAAGGA CGCCAAGAAG CACGCCGCCG ACCAATACTA GATCGATCCC GATCGAATGA
ACGCAAGAAC GAACGGTTTA TATGCTTAAT TACTTTCTCC CCATAATTAC ATGTATGCAT GTGGTTGATG GCTTAATTTG
CTTCTTCTTG TTCGTCGTCA TACGTCGTCG CTTTTACTTC GTGTTCATGT ACATTAATTC TGTATCCGCA CTGAGTATTA
AATAAGTGCG TTTGTGCTGC ACAC

Locus: Os02g0543000

Loading...

Locus: Os02g0543000

Loading...