Os02t0543000-02

Locus

Os02g0543000

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ASR1

CGSNL Gene Name

ABSCISIC ACID-STRESS-RIPENING-INDUCIBLE 1 PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsAsr1, OsASR3, ASR3, Asr3

Oryzabase Gene Name Synonym(s)

Abiotic Stress Responsive 3, "ABA-, stress and ripening-induced protein 3", "abscisic acid-, stress- and ripening (ASR) gene 3"

Transcript Evidence

AK063217 (DDBJ, Best hit)

Protein Evidence

Q6ESY3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to stress (GO:0006950)

Functional domain (InterPro)

ABA/WDS induced protein (IPR003496)

Full-length cDNA

001-112-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0543000-02)

RiceXPro (AK063217)

Others

Oryzabase (8404)

KEGG (Os02t0543000-02)

Transcript

463 bp

>Os02t0543000-02 Hypothetical conserved gene.
ACAGATCAACACCGGCAACCGACTAACTCTGTCTGAAGGAAGCTAAGATTATTAATCAGT
GAGTAGCTAGCCATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGAC
GGGGAGGAGGAGAGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCAC
CTCGCGCTGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAG
AAGCACGCCGCCGACCAATACTAGATCGATCCCGATCGAATGAACGCAAGAACGAACGGT
TTATATGCTTAATTACTTTCTCCCCATAATTACATGTATGCATGTGGTTGATGGCTTAAT
TTGCTTCTTCTTGTTCGTCGTCATACGTCGTCGCTTTTACTTCGTGTTCATGTACATTAA
TTCTGTATCCGCACTGAGTATTAAATAAGTGCGTTTGTGCTGC

CDS

192 bp

>Os02t0543000-02 Hypothetical conserved gene.
ATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGACGGGGAGGAGGAG
AGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCACCTCGCGCTGGGC
GCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAGAAGCACGCCGCC
GACCAATACTAG

Protein

64 aa

>Os02t0543000-02 Hypothetical conserved gene.
MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLALGAAGFAFHEHHEKKDAKKHAA
DQY*

5'UTR

chr02:20166405..20166476 (- strand) : 72 bp

CDS

chr02:20166293..20166404 (- strand) : 112 bp

chr02:20165869..20165948 (- strand) : 80 bp

3'UTR

chr02:20165670..20165868 (- strand) : 199 bp

FASTA

>Os02t0543000-02 class=Sequence position=chr02:20165670..20166476 (- strand)
ACAGATCAAC ACCGGCAACC GACTAACTCT GTCTGAAGGA AGCTAAGATT ATTAATCAGT GAGTAGCTAG CCATGGCTGA
GGAGAAGAAG CACCACCACC TGTTCCACCA CAAGAAGGAC GGGGAGGAGG AGAGCTCCGG CGTGGTGGAC TACGACAAGG
AGAAGAAGCA CCACAAGCAC CTCGAGCAGC TCGGCGGCCT CGGCGCCATC GCCGCCGGCG CCTACGCTCT CGTAAGTCAT
TAATTAGTAC ATTTGACCAC CACTATTACA AGAAAATCGA TTTTCGCAGA CGTATATGTC ATCCCCCACT TTAACTAACC
TATATGTTTT AGCCGCTTGG AAAAATCGAT TATGTAGTGG TGAACTATGA TCTAATGATA ACTACCTAGC CATAGCTGAT
TAATTAAGAG ATAATTAACG GAGAATTTAT TTGTGGTACG TCGTTGCAGC ACGAGAAGCA CCAGGCGAAG AAGGACACGG
AGAACGCGCA CGGGCACAAG GTGAAGGAGG AGGTGGCGGC GGTGGCCGCG CTGGGCGCCG CGGGGTTCGC CTTCCACGAG
CACCACGAGA AGAAGGACGC CAAGAAGCAC GCCGCCGACC AATACTAGAT CGATCCCGAT CGAATGAACG CAAGAACGAA
CGGTTTATAT GCTTAATTAC TTTCTCCCCA TAATTACATG TATGCATGTG GTTGATGGCT TAATTTGCTT CTTCTTGTTC
GTCGTCATAC GTCGTCGCTT TTACTTCGTG TTCATGTACA TTAATTCTGT ATCCGCACTG AGTATTAAAT AAGTGCGTTT
GTGCTGC

Locus: Os02g0543000

Loading...

Locus: Os02g0543000

Loading...