Os02t0543000-03

Locus

Os02g0543000

Description

Similar to Abscisic stress ripening protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ASR1

CGSNL Gene Name

ABSCISIC ACID-STRESS-RIPENING-INDUCIBLE 1 PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsAsr1, OsASR3, ASR3, Asr3

Oryzabase Gene Name Synonym(s)

Abiotic Stress Responsive 3, "ABA-, stress and ripening-induced protein 3", "abscisic acid-, stress- and ripening (ASR) gene 3"

Transcript Evidence

AK060261 (DDBJ, Best hit)

Protein Evidence

Q93VD6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-004-H03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0543000-03)

RiceXPro (AK060261)

Others

Oryzabase (8404)

KEGG (Os02t0543000-03)

Transcript

474 bp

>Os02t0543000-03 Similar to Abscisic stress ripening protein 1.
ACAGATCAACACCGGCAACCGACTAACTCTGTCTGAAGGAAGCTAAGATTATTAATCAGT
GAGTAGCTAGCCATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGAC
GGGGAGGAGGAGAGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCAC
CTCGAGCCGCGCTGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACG
CCAAGAAGCACGCCGCCGACCAATACTAGATCGATCCCGATCGAATGAACGCAAGAACGA
ACGGTTTATATGCTTAATTACTTTCTCCCCATAATTACATGTATGCATGTGGTTGATGGC
TTAATTTGCTTCTTCTTGTTCGTCGTCATACGTCGTCGCTTTTACTTCGTGTTCATGTAC
ATTAATTCTGTATCCGCACTGAGTATTAAATAAGTGCGTTTGTGCTGCACACAG

CDS

216 bp

>Os02t0543000-03 Similar to Abscisic stress ripening protein 1.
ATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGACGGGGAGGAGGAG
AGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCACCTCGAGCCGCGC
TGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAGAAGCACG
CCGCCGACCAATACTAGATCGATCCCGATCGAATGA

Protein

72 aa

>Os02t0543000-03 Similar to Abscisic stress ripening protein 1.
MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEPRWAPRGSPSTSTTRRRTPRST
PPTNTRSIPIE*

5'UTR

chr02:20166405..20166476 (- strand) : 72 bp

CDS

chr02:20166290..20166404 (- strand) : 115 bp

chr02:20165850..20165950 (- strand) : 101 bp

3'UTR

chr02:20165664..20165849 (- strand) : 186 bp

FASTA

>Os02t0543000-03 class=Sequence position=chr02:20165664..20166476 (- strand)
ACAGATCAAC ACCGGCAACC GACTAACTCT GTCTGAAGGA AGCTAAGATT ATTAATCAGT GAGTAGCTAG CCATGGCTGA
GGAGAAGAAG CACCACCACC TGTTCCACCA CAAGAAGGAC GGGGAGGAGG AGAGCTCCGG CGTGGTGGAC TACGACAAGG
AGAAGAAGCA CCACAAGCAC CTCGAGCAGC TCGGCGGCCT CGGCGCCATC GCCGCCGGCG CCTACGCTCT CGTAAGTCAT
TAATTAGTAC ATTTGACCAC CACTATTACA AGAAAATCGA TTTTCGCAGA CGTATATGTC ATCCCCCACT TTAACTAACC
TATATGTTTT AGCCGCTTGG AAAAATCGAT TATGTAGTGG TGAACTATGA TCTAATGATA ACTACCTAGC CATAGCTGAT
TAATTAAGAG ATAATTAACG GAGAATTTAT TTGTGGTACG TCGTTGCAGC ACGAGAAGCA CCAGGCGAAG AAGGACACGG
AGAACGCGCA CGGGCACAAG GTGAAGGAGG AGGTGGCGGC GGTGGCCGCG CTGGGCGCCG CGGGGTTCGC CTTCCACGAG
CACCACGAGA AGAAGGACGC CAAGAAGCAC GCCGCCGACC AATACTAGAT CGATCCCGAT CGAATGAACG CAAGAACGAA
CGGTTTATAT GCTTAATTAC TTTCTCCCCA TAATTACATG TATGCATGTG GTTGATGGCT TAATTTGCTT CTTCTTGTTC
GTCGTCATAC GTCGTCGCTT TTACTTCGTG TTCATGTACA TTAATTCTGT ATCCGCACTG AGTATTAAAT AAGTGCGTTT
GTGCTGCACA CAG

Locus: Os02g0543000

Loading...

Locus: Os02g0543000

Loading...