Os02t0543000-04

Locus

Os02g0543000

Description

"Abscisic acid-, stress-, and ripening-induced (ASR) protein", ABA-mediated regulation of stomatal closure, Salinity and drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsASR1

RAP-DB Gene Name Synonym(s)

"Abscisic acid-, stress-, and ripening-induced protein 1"

CGSNL Gene Symbol

ASR1

CGSNL Gene Name

ABSCISIC ACID-STRESS-RIPENING-INDUCIBLE 1 PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsAsr1, OsASR3, ASR3, Asr3

Oryzabase Gene Name Synonym(s)

Abiotic Stress Responsive 3, "ABA-, stress and ripening-induced protein 3", "abscisic acid-, stress- and ripening (ASR) gene 3"

Transcript Evidence

AK062319

Protein Evidence

A0A0P0VK35

Literature

PMID: 32117337

Note

Manual Curation

March 4, 2020

Functional domain (InterPro)

ABA/WDS induced protein (IPR003496)

Full-length cDNA

001-101-C07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0543000-04)

RiceXPro (AK062319)

Others

Oryzabase (8404)

Transcript

528 bp

>Os02t0543000-04 "Abscisic acid-, stress-, and ripening-induced (ASR) protein", ABA-mediated regulation of stomatal closure, Salinity and drought tolerance
ACAGATCAACACCGGCAACCGACTAACTCTGTCTGAAGGAAGCTAAGATTATTAATCAGT
GAGTAGCTAGCCATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGAC
GGGGAGGAGGAGAGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCAC
CTCGAGCAGCTCGGCGGCCTCGGCGCCATCGCCGCCGGCGCCTACGCTCTCCACGAGAAG
CACCAGGCGAAGAAGGACACGGAGAACGCGCCTTCCACGAGCACCACGAGAAGAAGGACG
CCAAGAAGCACGCCGCCGACCAATACTAGATCGATCCCGATCGAATGAACGCAAGAACGA
ACGGTTTATATGCTTAATTACTTTCTCCCCATAATTACATGTATGCATGTGGTTGATGGC
TTAATTTGCTTCTTCTTGTTCGTCGTCATACGTCGTCGCTTTTACTTCGTGTTCATGTAC
ATTAATTCTGTATCCGCACTGAGTATTAAATAAGTGCGTTTGTGCTGC

CDS

276 bp

>Os02t0543000-04 "Abscisic acid-, stress-, and ripening-induced (ASR) protein", ABA-mediated regulation of stomatal closure, Salinity and drought tolerance
ATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGACGGGGAGGAGGAG
AGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCACCTCGAGCAGCTC
GGCGGCCTCGGCGCCATCGCCGCCGGCGCCTACGCTCTCCACGAGAAGCACCAGGCGAAG
AAGGACACGGAGAACGCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAGAAGCACG
CCGCCGACCAATACTAGATCGATCCCGATCGAATGA

Protein

92 aa

>Os02t0543000-04 "Abscisic acid-, stress-, and ripening-induced (ASR) protein", ABA-mediated regulation of stomatal closure, Salinity and drought tolerance
MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEQLGGLGAIAAGAYALHEKHQAK
KDTENAPSTSTTRRRTPRSTPPTNTRSIPIE*

5'UTR

chr02:20166405..20166476 (- strand) : 72 bp

CDS

chr02:20166246..20166404 (- strand) : 159 bp

chr02:20165988..20166027 (- strand) : 40 bp

chr02:20165850..20165926 (- strand) : 77 bp

3'UTR

chr02:20165670..20165849 (- strand) : 180 bp

FASTA

>Os02t0543000-04 class=Sequence position=chr02:20165670..20166476 (- strand)
ACAGATCAAC ACCGGCAACC GACTAACTCT GTCTGAAGGA AGCTAAGATT ATTAATCAGT GAGTAGCTAG CCATGGCTGA
GGAGAAGAAG CACCACCACC TGTTCCACCA CAAGAAGGAC GGGGAGGAGG AGAGCTCCGG CGTGGTGGAC TACGACAAGG
AGAAGAAGCA CCACAAGCAC CTCGAGCAGC TCGGCGGCCT CGGCGCCATC GCCGCCGGCG CCTACGCTCT CGTAAGTCAT
TAATTAGTAC ATTTGACCAC CACTATTACA AGAAAATCGA TTTTCGCAGA CGTATATGTC ATCCCCCACT TTAACTAACC
TATATGTTTT AGCCGCTTGG AAAAATCGAT TATGTAGTGG TGAACTATGA TCTAATGATA ACTACCTAGC CATAGCTGAT
TAATTAAGAG ATAATTAACG GAGAATTTAT TTGTGGTACG TCGTTGCAGC ACGAGAAGCA CCAGGCGAAG AAGGACACGG
AGAACGCGCA CGGGCACAAG GTGAAGGAGG AGGTGGCGGC GGTGGCCGCG CTGGGCGCCG CGGGGTTCGC CTTCCACGAG
CACCACGAGA AGAAGGACGC CAAGAAGCAC GCCGCCGACC AATACTAGAT CGATCCCGAT CGAATGAACG CAAGAACGAA
CGGTTTATAT GCTTAATTAC TTTCTCCCCA TAATTACATG TATGCATGTG GTTGATGGCT TAATTTGCTT CTTCTTGTTC
GTCGTCATAC GTCGTCGCTT TTACTTCGTG TTCATGTACA TTAATTCTGT ATCCGCACTG AGTATTAAAT AAGTGCGTTT
GTGCTGC

Locus: Os02g0543000

Loading...

Locus: Os02g0543000

Loading...