Os02t0543000-05

Locus

Os02g0543000

Description

Abscisic stress ripening protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ASR1

CGSNL Gene Name

ABSCISIC ACID-STRESS-RIPENING-INDUCIBLE 1 PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsAsr1, OsASR3, ASR3, Asr3

Oryzabase Gene Name Synonym(s)

Abiotic Stress Responsive 3, "ABA-, stress and ripening-induced protein 3", "abscisic acid-, stress- and ripening (ASR) gene 3"

Transcript Evidence

AK062880 (DDBJ, Best hit)

Protein Evidence

A3A7S9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to stress (GO:0006950)

Functional domain (InterPro)

ABA/WDS induced protein (IPR003496)

Full-length cDNA

001-108-D04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0543000-05)

Others

Oryzabase (8404)

Transcript

597 bp

>Os02t0543000-05 Abscisic stress ripening protein 1.
GCACAGATCAACACCGGCAACCGACTAACTCTGTCTGAAGGAAGCTAAGATTATTAATCA
GTGAGTAGCTAGCCATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGG
ACGGGGAGGAGGAGAGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGC
ACCTCGAGCAGCTCGGCGGCCTCGGCGCCATCGCCGCCGGCGCCTACGCTCTCCACGAGA
AGCACCAGGCGAAGAAGGACACGGAGAACGCGCACGGGCACAAGGTGAAGGAGGAGGTGG
CGGCGGTGGCCGCGCTGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGG
ACGCCAAGAAGCACGCCGCCGACCAATACTAGATCGATCCCGATCGAATGAACGCAAGAA
CGAACGGTTTATATGCTTAATTACTTTCTCCCCATAATTACATGTATGCATGTGGTTGAT
GGCTTAATTTGCTTCTTCTTGTTCGTCGTCATACGTCGTCGCTTTTACTTCGTGTTCATG
TACATTAATTCTGTATCCGCACTGAGTATTAAATAAGTGCGTTTGTGCTGCACACAG

CDS

318 bp

>Os02t0543000-05 Abscisic stress ripening protein 1.
ATGGCTGAGGAGAAGAAGCACCACCACCTGTTCCACCACAAGAAGGACGGGGAGGAGGAG
AGCTCCGGCGTGGTGGACTACGACAAGGAGAAGAAGCACCACAAGCACCTCGAGCAGCTC
GGCGGCCTCGGCGCCATCGCCGCCGGCGCCTACGCTCTCCACGAGAAGCACCAGGCGAAG
AAGGACACGGAGAACGCGCACGGGCACAAGGTGAAGGAGGAGGTGGCGGCGGTGGCCGCG
CTGGGCGCCGCGGGGTTCGCCTTCCACGAGCACCACGAGAAGAAGGACGCCAAGAAGCAC
GCCGCCGACCAATACTAG

Protein

106 aa

>Os02t0543000-05 Abscisic stress ripening protein 1.
MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEQLGGLGAIAAGAYALHEKHQAK
KDTENAHGHKVKEEVAAVAALGAAGFAFHEHHEKKDAKKHAADQY*

5'UTR

chr02:20166405..20166478 (- strand) : 74 bp

CDS

chr02:20166246..20166404 (- strand) : 159 bp

chr02:20165869..20166027 (- strand) : 159 bp

3'UTR

chr02:20165664..20165868 (- strand) : 205 bp

FASTA

>Os02t0543000-05 class=Sequence position=chr02:20165664..20166478 (- strand)
GCACAGATCA ACACCGGCAA CCGACTAACT CTGTCTGAAG GAAGCTAAGA TTATTAATCA GTGAGTAGCT AGCCATGGCT
GAGGAGAAGA AGCACCACCA CCTGTTCCAC CACAAGAAGG ACGGGGAGGA GGAGAGCTCC GGCGTGGTGG ACTACGACAA
GGAGAAGAAG CACCACAAGC ACCTCGAGCA GCTCGGCGGC CTCGGCGCCA TCGCCGCCGG CGCCTACGCT CTCGTAAGTC
ATTAATTAGT ACATTTGACC ACCACTATTA CAAGAAAATC GATTTTCGCA GACGTATATG TCATCCCCCA CTTTAACTAA
CCTATATGTT TTAGCCGCTT GGAAAAATCG ATTATGTAGT GGTGAACTAT GATCTAATGA TAACTACCTA GCCATAGCTG
ATTAATTAAG AGATAATTAA CGGAGAATTT ATTTGTGGTA CGTCGTTGCA GCACGAGAAG CACCAGGCGA AGAAGGACAC
GGAGAACGCG CACGGGCACA AGGTGAAGGA GGAGGTGGCG GCGGTGGCCG CGCTGGGCGC CGCGGGGTTC GCCTTCCACG
AGCACCACGA GAAGAAGGAC GCCAAGAAGC ACGCCGCCGA CCAATACTAG ATCGATCCCG ATCGAATGAA CGCAAGAACG
AACGGTTTAT ATGCTTAATT ACTTTCTCCC CATAATTACA TGTATGCATG TGGTTGATGG CTTAATTTGC TTCTTCTTGT
TCGTCGTCAT ACGTCGTCGC TTTTACTTCG TGTTCATGTA CATTAATTCT GTATCCGCAC TGAGTATTAA ATAAGTGCGT
TTGTGCTGCA CACAG

Locus: Os02g0543000

Loading...

Locus: Os02g0543000

Loading...