Os02t0550600-01

Locus

Os02g0550600

Description

Alkaline/neutral invertase, Root cell development, Pollen development, Regulation of floral transition

RAP-DB Gene Symbol Synonym(s)

OsCYT-INV1, OsCyt-inv1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN8

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 8

Oryzabase Gene Symbol Synonym(s)

OsNIN8

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 8

Transcript Evidence

AK102741

Protein Evidence

Q69T31

Literature

PMID: 18317796

Note

Manual Curation

February 2, 2021

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: glycopeptide alpha-N-acetylgalactosaminidase activity (GO:0033926)

Functional domain (InterPro)

Six-hairpin glycosidase superfamily (IPR008928)

Glycosyl hydrolase family 100 (IPR024746)

Full-length cDNA

J033106F23 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0550600-01)

RiceXPro (AK102741)

Others

Oryzabase (14673)

KEGG (Os02t0550600-01)

Transcript

2449 bp

>Os02t0550600-01 Alkaline/neutral invertase, Root cell development, Pollen development, Regulation of floral transition
ATCGAGATTCGCGTGGCCTTGTGGTCACCGCCGCCGCCGCCGCCTAGATCTCTCGCTGCG
TCTCTCCCTCCCTCCCCTCCGGCGATCCGCGTAGATCTGGGCGGGAGGCGGCGGAGATCC
GCGGCGAGGAGGGGAGGGAGGGGAAGCAAGCAAGCAAAGCGGAGGGGCATGGAGCTGGCG
GTGGGAGCGGGCGGGATGCGGAGGTCGGCGTCGCACACGTCGCTGTCGGAGTCGGACGAC
TTCGACCTGTCGCGGCTGCTGAACAAGCCGCGGATCAACGTCGAGCGGCAGCGCTCGTTC
GACGACCGCTCGCTCAGCGACGTCTCCTACTCCGGCGGCGGCCACGGCGGCACCAGGGGC
GGCTTCGACGGCATGTACTCGCCGGGGGGTGGCCTGCGGTCGCTCGTCGGCACCCCGGCC
TCCTCCGCGCTCCACTCCTTCGAGCCCCACCCCATCGTCGGCGACGCCTGGGAGGCGCTC
CGCCGCTCGCTCGTCTTCTTCCGCGGCCAGCCCCTCGGCACCATCGCCGCCTTCGACCAC
GCCTCCGAGGAGGTCCTCAACTACGACCAGGTGTTCGTGAGGGATTTCGTGCCGAGCGCG
CTGGCGTTCCTGATGAACGGCGAGCCGGAGATCGTGAGGCACTTCCTGCTCAAGACGCTC
CTGCTGCAGGGCTGGGAGAAGAAGGTCGATCGGTTCAAGCTCGGGGAGGGCGCCATGCCG
GCCAGCTTCAAAGTGCTCCATGACTCCAAGAAGGGCGTCGACACCCTGCATGCGGATTTC
GGGGAGAGCGCCATTGGCAGGGTGGCTCCCGTGGATTCGGGGTTCTGGTGGATCATACTT
CTACGGGCATACACCAAGTCCACCGGGGATCTCACGCTCGCGGAGACGCCGGAATGCCAG
AAGGGAATGAGGCTGATACTGAGCCTGTGCTTGTCTGAGGGGTTTGATACCTTCCCAACA
TTGCTGTGTGCAGACGGTTGCTGCATGATAGATCGCAGAATGGGTGTTTATGGGTACCCT
ATTGAGATTCAAGCCCTGTTCTTTATGGCACTAAGGTGTGCTCTTCAATTGCTTAAGCAT
GATAACGAAGGGAAAGAGTTTGTAGAGAGGATTGCAACTCGTCTTCACGCTCTAAGTTAT
CACATGCGGAGTTACTATTGGCTTGATTTCCAGCAGCTAAATGATATTTATCGCTATAAG
ACAGAGGAATATTCCCACACTGCTGTCAACAAATTCAATGTCATCCCAGATTCTATTCCG
GATTGGTTATTTGATTTTATGCCTTGCCAGGGTGGTTTTTTCATTGGTAATGTTAGTCCT
GCAAGGATGGACTTCCGGTGGTTTGCACTTGGAAACATGATTGCTATACTATCATCCCTT
GCTACACCTGAGCAATCAACGGCCATAATGGATCTCATTGAGGAGCGATGGGAAGAGCTT
ATTGGTGAAATGCCTCTGAAGATATGCTACCCTGCTATTGAGAATCACGAATGGCGTATT
GTGACAGGCTGTGATCCGAAGAATACTAGATGGAGTTACCACAATGGAGGATCTTGGCCA
GTACTACTATGGCTGCTCACAGCAGCCTGCATCAAGACTGGCCGGCCACAAATTGCAAGG
CGTGCAATTGACTTAGCTGAGAGAAGGCTGTTGAAGGATGGTTGGCCAGAGTACTATGAT
GGGAAGCTTGGGCGGTATGTCGGCAAGCAGGCAAGGAAATTCCAGACTTGGTCTATCGCA
GGGTATTTGGTCGCCAAGATGATGCTTGAGGACCCTTCTCATCTCGGAATGATATCACTA
GAGGAGGATAAGGCAATGAAGCCTGTTTTGAAGAGGTCTGCCTCATGGACAAACTAAGAT
GTCGACGAAAATTTTTAGGGAAGCAAAGTCAGTTTGGGAACAAAAATTCTTTTGGTAGCT
CTTCTCTGCTCATCCCTCCGTTTGACTTTTCGAACCGGAAAGGTTTGTTTCATCTGGATT
TCCCGGTTGTACAATATGTCAGCCCATTTCTTAGCTAAAAAGAAGCAATTGCGGAAATGG
GTGTTTTGGTTTCAATCCCTGCTTGTAAGAAGATTCCTGCTTTGGGTCAAAAATCTTAAA
GCTGATTCCAGTTTCCTGGTCTTTTGATGGAGAGAAGTGCTACTCTAACGAATAATAAAA
GCTCATTTTTCTGCAGTGCCTCCTATCCAGAGGGTTCGTTAACTTGCTGCCTGAGAAGGG
CAAGTCATACAAACTGTGTGCCTTGTATGTTTCTTCCTCTTTTCGTTCTCTTACAAAATT
GAAGTTGTACTTGTGTTCAAGGAAAGATCTTGGCAAAAGCTTTTCCCTGGTCCCCTGGTT
GGATATCACAGTATCTTGGGTTCTTGAGACATTGTTGGAACATGCTTGCTAGTTTGTGCA
AGCAAGTGATAATAATTCATTTGGAGTTATCTCAACGACTTTATCTTCG

CDS

1689 bp

>Os02t0550600-01 Alkaline/neutral invertase, Root cell development, Pollen development, Regulation of floral transition
ATGGAGCTGGCGGTGGGAGCGGGCGGGATGCGGAGGTCGGCGTCGCACACGTCGCTGTCG
GAGTCGGACGACTTCGACCTGTCGCGGCTGCTGAACAAGCCGCGGATCAACGTCGAGCGG
CAGCGCTCGTTCGACGACCGCTCGCTCAGCGACGTCTCCTACTCCGGCGGCGGCCACGGC
GGCACCAGGGGCGGCTTCGACGGCATGTACTCGCCGGGGGGTGGCCTGCGGTCGCTCGTC
GGCACCCCGGCCTCCTCCGCGCTCCACTCCTTCGAGCCCCACCCCATCGTCGGCGACGCC
TGGGAGGCGCTCCGCCGCTCGCTCGTCTTCTTCCGCGGCCAGCCCCTCGGCACCATCGCC
GCCTTCGACCACGCCTCCGAGGAGGTCCTCAACTACGACCAGGTGTTCGTGAGGGATTTC
GTGCCGAGCGCGCTGGCGTTCCTGATGAACGGCGAGCCGGAGATCGTGAGGCACTTCCTG
CTCAAGACGCTCCTGCTGCAGGGCTGGGAGAAGAAGGTCGATCGGTTCAAGCTCGGGGAG
GGCGCCATGCCGGCCAGCTTCAAAGTGCTCCATGACTCCAAGAAGGGCGTCGACACCCTG
CATGCGGATTTCGGGGAGAGCGCCATTGGCAGGGTGGCTCCCGTGGATTCGGGGTTCTGG
TGGATCATACTTCTACGGGCATACACCAAGTCCACCGGGGATCTCACGCTCGCGGAGACG
CCGGAATGCCAGAAGGGAATGAGGCTGATACTGAGCCTGTGCTTGTCTGAGGGGTTTGAT
ACCTTCCCAACATTGCTGTGTGCAGACGGTTGCTGCATGATAGATCGCAGAATGGGTGTT
TATGGGTACCCTATTGAGATTCAAGCCCTGTTCTTTATGGCACTAAGGTGTGCTCTTCAA
TTGCTTAAGCATGATAACGAAGGGAAAGAGTTTGTAGAGAGGATTGCAACTCGTCTTCAC
GCTCTAAGTTATCACATGCGGAGTTACTATTGGCTTGATTTCCAGCAGCTAAATGATATT
TATCGCTATAAGACAGAGGAATATTCCCACACTGCTGTCAACAAATTCAATGTCATCCCA
GATTCTATTCCGGATTGGTTATTTGATTTTATGCCTTGCCAGGGTGGTTTTTTCATTGGT
AATGTTAGTCCTGCAAGGATGGACTTCCGGTGGTTTGCACTTGGAAACATGATTGCTATA
CTATCATCCCTTGCTACACCTGAGCAATCAACGGCCATAATGGATCTCATTGAGGAGCGA
TGGGAAGAGCTTATTGGTGAAATGCCTCTGAAGATATGCTACCCTGCTATTGAGAATCAC
GAATGGCGTATTGTGACAGGCTGTGATCCGAAGAATACTAGATGGAGTTACCACAATGGA
GGATCTTGGCCAGTACTACTATGGCTGCTCACAGCAGCCTGCATCAAGACTGGCCGGCCA
CAAATTGCAAGGCGTGCAATTGACTTAGCTGAGAGAAGGCTGTTGAAGGATGGTTGGCCA
GAGTACTATGATGGGAAGCTTGGGCGGTATGTCGGCAAGCAGGCAAGGAAATTCCAGACT
TGGTCTATCGCAGGGTATTTGGTCGCCAAGATGATGCTTGAGGACCCTTCTCATCTCGGA
ATGATATCACTAGAGGAGGATAAGGCAATGAAGCCTGTTTTGAAGAGGTCTGCCTCATGG
ACAAACTAA

Protein

563 aa

>Os02t0550600-01 Alkaline/neutral invertase, Root cell development, Pollen development, Regulation of floral transition
MELAVGAGGMRRSASHTSLSESDDFDLSRLLNKPRINVERQRSFDDRSLSDVSYSGGGHG
GTRGGFDGMYSPGGGLRSLVGTPASSALHSFEPHPIVGDAWEALRRSLVFFRGQPLGTIA
AFDHASEEVLNYDQVFVRDFVPSALAFLMNGEPEIVRHFLLKTLLLQGWEKKVDRFKLGE
GAMPASFKVLHDSKKGVDTLHADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLTLAET
PECQKGMRLILSLCLSEGFDTFPTLLCADGCCMIDRRMGVYGYPIEIQALFFMALRCALQ
LLKHDNEGKEFVERIATRLHALSYHMRSYYWLDFQQLNDIYRYKTEEYSHTAVNKFNVIP
DSIPDWLFDFMPCQGGFFIGNVSPARMDFRWFALGNMIAILSSLATPEQSTAIMDLIEER
WEELIGEMPLKICYPAIENHEWRIVTGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRP
QIARRAIDLAERRLLKDGWPEYYDGKLGRYVGKQARKFQTWSIAGYLVAKMMLEDPSHLG
MISLEEDKAMKPVLKRSASWTN*

5'UTR

chr02:20721564..20721731 (- strand) : 168 bp

CDS

chr02:20721162..20721563 (- strand) : 402 bp

chr02:20720615..20721046 (- strand) : 432 bp

chr02:20719217..20719775 (- strand) : 559 bp

chr02:20718490..20718785 (- strand) : 296 bp

3'UTR

chr02:20717898..20718489 (- strand) : 592 bp

FASTA

>Os02t0550600-01 class=Sequence position=chr02:20717898..20721731 (- strand)
ATCGAGATTC GCGTGGCCTT GTGGTCACCG CCGCCGCCGC CGCCTAGATC TCTCGCTGCG TCTCTCCCTC CCTCCCCTCC
GGCGATCCGC GTAGATCTGG GCGGGAGGCG GCGGAGATCC GCGGCGAGGA GGGGAGGGAG GGGAAGCAAG CAAGCAAAGC
GGAGGGGCAT GGAGCTGGCG GTGGGAGCGG GCGGGATGCG GAGGTCGGCG TCGCACACGT CGCTGTCGGA GTCGGACGAC
TTCGACCTGT CGCGGCTGCT GAACAAGCCG CGGATCAACG TCGAGCGGCA GCGCTCGTTC GACGACCGCT CGCTCAGCGA
CGTCTCCTAC TCCGGCGGCG GCCACGGCGG CACCAGGGGC GGCTTCGACG GCATGTACTC GCCGGGGGGT GGCCTGCGGT
CGCTCGTCGG CACCCCGGCC TCCTCCGCGC TCCACTCCTT CGAGCCCCAC CCCATCGTCG GCGACGCCTG GGAGGCGCTC
CGCCGCTCGC TCGTCTTCTT CCGCGGCCAG CCCCTCGGCA CCATCGCCGC CTTCGACCAC GCCTCCGAGG AGGTCCTCAA
CTACGACCAG GTTGGTTAGC TATTCGCGGC GGCGGCGCTT TCGGATTGTG CGGATTCAGC TCATCTGGAA ACCGCATGGC
TTGTCTCATC TGGGGAGCTT TTGCTTTGCT TTGCTTTGCT CGCAGGTGTT CGTGAGGGAT TTCGTGCCGA GCGCGCTGGC
GTTCCTGATG AACGGCGAGC CGGAGATCGT GAGGCACTTC CTGCTCAAGA CGCTCCTGCT GCAGGGCTGG GAGAAGAAGG
TCGATCGGTT CAAGCTCGGG GAGGGCGCCA TGCCGGCCAG CTTCAAAGTG CTCCATGACT CCAAGAAGGG CGTCGACACC
CTGCATGCGG ATTTCGGGGA GAGCGCCATT GGCAGGGTGG CTCCCGTGGA TTCGGGGTTC TGGTGGATCA TACTTCTACG
GGCATACACC AAGTCCACCG GGGATCTCAC GCTCGCGGAG ACGCCGGAAT GCCAGAAGGG AATGAGGCTG ATACTGAGCC
TGTGCTTGTC TGAGGGGTTT GATACCTTCC CAACATTGCT GTGTGCAGAC GGTTGCTGCA TGATAGATCG CAGAATGGTA
AACTTTACTG TGGCGCTCAA GTTTTTTTTT TTTATAAAAA CATGTTTCAA ACTCACAAGT GTATAAACTA TAATTAACAT
TTCTATTATA ACGGAAGCAT CTGGTCTGAT TTTTGCTGAC AGTAACATCA CTAATAAACT TTTGGATAAT TTACCATTTG
TACCAAAAGT CATGACGCTG TAGATTTAAT TTTACATTGG TATTGGTTAA ATTATGTGAG ATTTCAGTAA TTTCATGACA
ATTTGCTTGA TTTCTGTGAT CTGCCTGCAA CATATTTGAT TCTTCATACG ATAACTTTCT TGTGGTTTGA ATGATTCTTC
ATCTTCATAC AGTTAATATA TTGCACATTG GCAGCACTAT TTTATAACTG GGACAGGGCT CTCAGTTCGT TCTTGTGGGC
GCGGTTTAGA TTTCAAATGC CATTACTATA TTTGAACCTA CATTTGCTAA TGAGTGGAGA ATATCATATA GGCATGTAGC
CTTCTGCTTG CTTCATCTGC TGGATCCTGC TTTTACCATT TGTATGGGTC CATGCCCTAA TACGTGGACA TGCAACACTC
TACTCAGTCC TGATAACTGT CCCCTTTCTT GTTATATGAA GTTCCAGATG CTATTTTGGT TACACAGAAG TGTAGAATAG
AAATTAGAAT TATGGAAATC GCTGATAGAT CTGTTTACTT GTGAACATTT GTTTCTGACT TTTCACATAT GCTTCTGATA
TGTCTTATGT CTTTATGAGT AACTGATGAG CTCATGGGCT GTAATGCTTA CTTAAATCAA AATGGCCTAT GGCTAAGCTT
CCTTTTGCTC ACTCCTGTTG TTGATCTTTG TTGTAGGGTG TTTATGGGTA CCCTATTGAG ATTCAAGCCC TGTTCTTTAT
GGCACTAAGG TGTGCTCTTC AATTGCTTAA GCATGATAAC GAAGGGAAAG AGTTTGTAGA GAGGATTGCA ACTCGTCTTC
ACGCTCTAAG TTATCACATG CGGAGTTACT ATTGGCTTGA TTTCCAGCAG CTAAATGATA TTTATCGCTA TAAGACAGAG
GAATATTCCC ACACTGCTGT CAACAAATTC AATGTCATCC CAGATTCTAT TCCGGATTGG TTATTTGATT TTATGCCTTG
CCAGGGTGGT TTTTTCATTG GTAATGTTAG TCCTGCAAGG ATGGACTTCC GGTGGTTTGC ACTTGGAAAC ATGATTGCTA
TACTATCATC CCTTGCTACA CCTGAGCAAT CAACGGCCAT AATGGATCTC ATTGAGGAGC GATGGGAAGA GCTTATTGGT
GAAATGCCTC TGAAGATATG CTACCCTGCT ATTGAGAATC ACGAATGGCG TATTGTGACA GGCTGTGATC CGAAGAATAC
TAGATGGAGT TACCACAATG GAGGATCTTG GCCAGGTTAG AAGGTTTTCT TATTATTTAA ATCTCTCTTA AATATTACAG
TTTTTAGTCG CAAAAATGTT ATCATGCTTC CCTTTTATCA TTATGTGATT TGGACGCTGA ATTAAACCAA TTGATAACCA
TATACCATCT TTCGGTGATT AGTGAAGGAC CATATACATT TGTGCCCAAG ATTTCTGTTT ATGAGCTATG GCCTTAAATG
AAATTTTTAT GTGCTGAGAA GAGCAATGTT TATTAAATTT GATGCCTTCT CTTTTTTCCT CACGGAGTCA CGGTACATGT
GCCCATGAAA CCTACGTATA AACATATAAC ATCACATTAT ATCTCTTCTG ATTTTCTGTG TTATTTGTAC TACAAACGGA
TAGCATGACA TTGAGTAACT TCAACATGTT ATAACTTTAA CACAATTTTT CCCATTCTTT CTGCAGTACT ACTATGGCTG
CTCACAGCAG CCTGCATCAA GACTGGCCGG CCACAAATTG CAAGGCGTGC AATTGACTTA GCTGAGAGAA GGCTGTTGAA
GGATGGTTGG CCAGAGTACT ATGATGGGAA GCTTGGGCGG TATGTCGGCA AGCAGGCAAG GAAATTCCAG ACTTGGTCTA
TCGCAGGGTA TTTGGTCGCC AAGATGATGC TTGAGGACCC TTCTCATCTC GGAATGATAT CACTAGAGGA GGATAAGGCA
ATGAAGCCTG TTTTGAAGAG GTCTGCCTCA TGGACAAACT AAGATGTCGA CGAAAATTTT TAGGGAAGCA AAGTCAGTTT
GGGAACAAAA ATTCTTTTGG TAGCTCTTCT CTGCTCATCC CTCCGTTTGA CTTTTCGAAC CGGAAAGGTT TGTTTCATCT
GGATTTCCCG GTTGTACAAT ATGTCAGCCC ATTTCTTAGC TAAAAAGAAG CAATTGCGGA AATGGGTGTT TTGGTTTCAA
TCCCTGCTTG TAAGAAGATT CCTGCTTTGG GTCAAAAATC TTAAAGCTGA TTCCAGTTTC CTGGTCTTTT GATGGAGAGA
AGTGCTACTC TAACGAATAA TAAAAGCTCA TTTTTCTGCA GTGCCTCCTA TCCAGAGGGT TCGTTAACTT GCTGCCTGAG
AAGGGCAAGT CATACAAACT GTGTGCCTTG TATGTTTCTT CCTCTTTTCG TTCTCTTACA AAATTGAAGT TGTACTTGTG
TTCAAGGAAA GATCTTGGCA AAAGCTTTTC CCTGGTCCCC TGGTTGGATA TCACAGTATC TTGGGTTCTT GAGACATTGT
TGGAACATGC TTGCTAGTTT GTGCAAGCAA GTGATAATAA TTCATTTGGA GTTATCTCAA CGACTTTATC TTCG

Locus: Os02g0550600

Loading...

Locus: Os02g0550600

Loading...