Os02t0554000-01

Locus

Os02g0554000

Description

SET domain domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SDG725

CGSNL Gene Name

SET DOMAIN GROUP PROTEIN 725

Oryzabase Gene Symbol Synonym(s)

OsSDG725, OsSET8, ASHH2

Oryzabase Gene Name Synonym(s)

SET Domain Group Protein725, SET DOMAIN GROUP725, SET protein 8, "ABSENT, SMALL, OR HOMEOTIC DISCS 1 HOMOLOG 2"

Transcript Evidence

AK064575 (DDBJ, Best hit)

Protein Evidence

B9F0I7 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Functional domain (InterPro)

SET domain (IPR001214)

Post-SET domain (IPR003616)

AWS (IPR006560)

Zinc finger, CW-type (IPR011124)

Full-length cDNA

002-112-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0554000-01)

Others

Oryzabase (11165)

Transcript

2280 bp

>Os02t0554000-01 SET domain domain containing protein.
AGTCATGGAGGAAAGAAGGGTAAGGTGCGGGATCCACATGGGAAGGGCAGAAGCAAGAAG
AAAAATATAGCTGATAACACCTACGGTTTGCCGGCTCAGTTAACTGACCTGTCAGAACCT
CGCATGAATAAACAGAGTGATCTTATTCCTGCTGCTGAACTTGTATTCAAGAACTCTTCT
GCCGTATCTGTTGAATTACCTGCAGTTGTTGCTTGCAAAACTGATGGTGCATCTGTACCA
CCAGCACCTgcttgggtttgttgtgatgattgcgaaaaatggcgctgcataccaactgaa
ctggcagataaaatctcaaaagaaaatctcagatgGACTTGTAAGGAAAACGAAGATAAG
ACATTTGCCAATTGCTCTATACCACAAGAGAAGACAGATGATGAGATCAATGCAGAGCTT
GGGCTTTCAGATGCTTCTGCTGATGAAGCTAATGGCGATGGATCAAACTCGAAAGCTTCT
GGAGAACCAAACTTTGCACTTCTCAGGTCAAACTTGTTTCTACATCGTAACCGCAGGACA
CAATCCATTGATGAGAGCATGGTATGCAATTGTAAGCCGCCTCACGATGACCGAATGGGT
TGTAGAGATGGTTGCTTGAACAGGATACTCAACATTGAATGCACCAAACGTACATGTCCA
TGTGGGGAGCACTGTTCCAATCAGCAGTTCCAAAGGCGCACCTATGCAAAACTTGGTAAG
TTCCATACTGGTAAAAAGGGCTATGGATTGCAATTGAAGGAAGATGTATCTGAAGGACGA
TTCCTCATTGAATATGTTGGAGAGGTCCTTGATATAACGGCTTATGAATCCCGCCAAAGG
TATTATGCCTCTAAAGGCCAGAAGCATTTCTATTTCATGGCACTTAATGGTGGTGAGGTG
ATAGATGCTTGTACTAAAGGAAACTTGGGCCGGTTCATCAATCATAGCTGCAGTCCTAAT
TGCCGTACAGAGAAGTGGATGGTCAATGGTGAAGTCTGCATTGGAATATTTGCTATGAGG
AACATCAAGAAGGGTGAAGAATTGACGTTTGATTACAACTATGTTCGTGTATCTGGTGCT
GCTCCTCAGAAATGCTTTTGCGGTACTGCCAAATGCCGGGGTTACATCGGTGGTGACATA
TCAGGTGCTGATATGATTACTCAAGATGATGCTGAAGCAGGGACTTTCGAACCTATGGCT
GTTCAGGAGGATGCTGAGGAAGTACTTGGTGCAAATGGTTTGTCCTCTCATGGCACACAT
CTAGATATTGTCGACCATGAAGCTTCCACTAAAACAGAAGATTCAAATGATTGCCCATCT
GTGAACCCACCAGAGTTAGAATCTGAGCAACAAACTTCAGGAACCTTATTTGACACAAGT
GAGCCAGAAAATTCCTTAGAAGCATTGAGCCCACAGGATGATGAAGATGTCGTCCGCACA
CCTGTCCATGTGTCCCGGACAGTTGAGAGTACGTCGCGGCAGTTTCCAGAATATGGTACT
CGGTCATCAGAAATTTTGCAAAGGGCTCCATGCACACTGGATGGACCAAAGGTTCCAAGC
ACAACAAATGGAATTCCGCCTAGTTCCGATTTGGGGAGCCACTGGGTACCAGGTTTCCAC
GCTAATAAGAAAACCAATGTAAAACATCATTTGATTCTGAATCCATCATCAGCTCCTATT
GACAGTGAGCACATTTTGGGAGTTGAAGGAAGATTGAACAGCTTGCTTGATGTAAATGGA
GGTATTAGCAAACGAAAAGACGCAACAAATGGATACTTGAAGCTTCTCCTTGTGACTGCA
GCGGAAGGTGACAATGCTGGGGGCACGTCTAAAAGTGTAAGGGATCTTTCGTTAATTCTT
GATGCACTTCTGAAAACAAGATCCAATTCTGTCCTGTTGGATATCATCAATAAGAATGGA
CTGCAAATGCTTCACAATATATTAAAGCAGAATAAAAGCGATTTCCATAGGATACCTATA
ATAAGAAAGCTTGTGAAGGTTTGCATTTCTTTTTTATGTTATGTCTTATTACATTAGTTT
CCAATTAATATATCACATTAGAGCAAGTACATCCCTTAACAACTGATCTAGGTGCTACAG
TGGACATATCAACCCCCACAAGATCCTTGTTATCTACTCCCTCTGATTCTTTTATGACTT
GTGCACAAAAATCAAGAAAAAAAAACTCAAAATGACTATTGTCCTTCATTTATGCTGCAC
TGGAAAAGATGATAATGTATTTTGTGAGATGGTGGCATTTATTTGGCAAGGGCAAACAAG

CDS

2037 bp

>Os02t0554000-01 SET domain domain containing protein.
AGTCATGGAGGAAAGAAGGGTAAGGTGCGGGATCCACATGGGAAGGGCAGAAGCAAGAAG
AAAAATATAGCTGATAACACCTACGGTTTGCCGGCTCAGTTAACTGACCTGTCAGAACCT
CGCATGAATAAACAGAGTGATCTTATTCCTGCTGCTGAACTTGTATTCAAGAACTCTTCT
GCCGTATCTGTTGAATTACCTGCAGTTGTTGCTTGCAAAACTGATGGTGCATCTGTACCA
CCAGCACCTgcttgggtttgttgtgatgattgcgaaaaatggcgctgcataccaactgaa
ctggcagataaaatctcaaaagaaaatctcagatgGACTTGTAAGGAAAACGAAGATAAG
ACATTTGCCAATTGCTCTATACCACAAGAGAAGACAGATGATGAGATCAATGCAGAGCTT
GGGCTTTCAGATGCTTCTGCTGATGAAGCTAATGGCGATGGATCAAACTCGAAAGCTTCT
GGAGAACCAAACTTTGCACTTCTCAGGTCAAACTTGTTTCTACATCGTAACCGCAGGACA
CAATCCATTGATGAGAGCATGGTATGCAATTGTAAGCCGCCTCACGATGACCGAATGGGT
TGTAGAGATGGTTGCTTGAACAGGATACTCAACATTGAATGCACCAAACGTACATGTCCA
TGTGGGGAGCACTGTTCCAATCAGCAGTTCCAAAGGCGCACCTATGCAAAACTTGGTAAG
TTCCATACTGGTAAAAAGGGCTATGGATTGCAATTGAAGGAAGATGTATCTGAAGGACGA
TTCCTCATTGAATATGTTGGAGAGGTCCTTGATATAACGGCTTATGAATCCCGCCAAAGG
TATTATGCCTCTAAAGGCCAGAAGCATTTCTATTTCATGGCACTTAATGGTGGTGAGGTG
ATAGATGCTTGTACTAAAGGAAACTTGGGCCGGTTCATCAATCATAGCTGCAGTCCTAAT
TGCCGTACAGAGAAGTGGATGGTCAATGGTGAAGTCTGCATTGGAATATTTGCTATGAGG
AACATCAAGAAGGGTGAAGAATTGACGTTTGATTACAACTATGTTCGTGTATCTGGTGCT
GCTCCTCAGAAATGCTTTTGCGGTACTGCCAAATGCCGGGGTTACATCGGTGGTGACATA
TCAGGTGCTGATATGATTACTCAAGATGATGCTGAAGCAGGGACTTTCGAACCTATGGCT
GTTCAGGAGGATGCTGAGGAAGTACTTGGTGCAAATGGTTTGTCCTCTCATGGCACACAT
CTAGATATTGTCGACCATGAAGCTTCCACTAAAACAGAAGATTCAAATGATTGCCCATCT
GTGAACCCACCAGAGTTAGAATCTGAGCAACAAACTTCAGGAACCTTATTTGACACAAGT
GAGCCAGAAAATTCCTTAGAAGCATTGAGCCCACAGGATGATGAAGATGTCGTCCGCACA
CCTGTCCATGTGTCCCGGACAGTTGAGAGTACGTCGCGGCAGTTTCCAGAATATGGTACT
CGGTCATCAGAAATTTTGCAAAGGGCTCCATGCACACTGGATGGACCAAAGGTTCCAAGC
ACAACAAATGGAATTCCGCCTAGTTCCGATTTGGGGAGCCACTGGGTACCAGGTTTCCAC
GCTAATAAGAAAACCAATGTAAAACATCATTTGATTCTGAATCCATCATCAGCTCCTATT
GACAGTGAGCACATTTTGGGAGTTGAAGGAAGATTGAACAGCTTGCTTGATGTAAATGGA
GGTATTAGCAAACGAAAAGACGCAACAAATGGATACTTGAAGCTTCTCCTTGTGACTGCA
GCGGAAGGTGACAATGCTGGGGGCACGTCTAAAAGTGTAAGGGATCTTTCGTTAATTCTT
GATGCACTTCTGAAAACAAGATCCAATTCTGTCCTGTTGGATATCATCAATAAGAATGGA
CTGCAAATGCTTCACAATATATTAAAGCAGAATAAAAGCGATTTCCATAGGATACCTATA
ATAAGAAAGCTTGTGAAGGTTTGCATTTCTTTTTTATGTTATGTCTTATTACATTAG

Protein

679 aa

>Os02t0554000-01 SET domain domain containing protein.
SHGGKKGKVRDPHGKGRSKKKNIADNTYGLPAQLTDLSEPRMNKQSDLIPAAELVFKNSS
AVSVELPAVVACKTDGASVPPAPAWVCCDDCEKWRCIPTELADKISKENLRWTCKENEDK
TFANCSIPQEKTDDEINAELGLSDASADEANGDGSNSKASGEPNFALLRSNLFLHRNRRT
QSIDESMVCNCKPPHDDRMGCRDGCLNRILNIECTKRTCPCGEHCSNQQFQRRTYAKLGK
FHTGKKGYGLQLKEDVSEGRFLIEYVGEVLDITAYESRQRYYASKGQKHFYFMALNGGEV
IDACTKGNLGRFINHSCSPNCRTEKWMVNGEVCIGIFAMRNIKKGEELTFDYNYVRVSGA
APQKCFCGTAKCRGYIGGDISGADMITQDDAEAGTFEPMAVQEDAEEVLGANGLSSHGTH
LDIVDHEASTKTEDSNDCPSVNPPELESEQQTSGTLFDTSEPENSLEALSPQDDEDVVRT
PVHVSRTVESTSRQFPEYGTRSSEILQRAPCTLDGPKVPSTTNGIPPSSDLGSHWVPGFH
ANKKTNVKHHLILNPSSAPIDSEHILGVEGRLNSLLDVNGGISKRKDATNGYLKLLLVTA
AEGDNAGGTSKSVRDLSLILDALLKTRSNSVLLDIINKNGLQMLHNILKQNKSDFHRIPI
IRKLVKVCISFLCYVLLH*

CDS

chr02:20900191..20900326 (+ strand) : 136 bp

chr02:20900422..20900620 (+ strand) : 199 bp

chr02:20901541..20901680 (+ strand) : 140 bp

chr02:20901790..20901869 (+ strand) : 80 bp

chr02:20903160..20903291 (+ strand) : 132 bp

chr02:20903365..20903481 (+ strand) : 117 bp

chr02:20904115..20904207 (+ strand) : 93 bp

chr02:20904487..20904564 (+ strand) : 78 bp

chr02:20904768..20904824 (+ strand) : 57 bp

chr02:20905149..20905818 (+ strand) : 670 bp

chr02:20905901..20905956 (+ strand) : 56 bp

chr02:20906493..20906569 (+ strand) : 77 bp

chr02:20906641..20906723 (+ strand) : 83 bp

chr02:20906814..20906932 (+ strand) : 119 bp

3'UTR

chr02:20906933..20907175 (+ strand) : 243 bp

FASTA

>Os02t0554000-01 class=Sequence position=chr02:20900191..20907175 (+ strand)
AGTCATGGAG GAAAGAAGGG TAAGGTGCGG GATCCACATG GGAAGGGCAG AAGCAAGAAG AAAAATATAG CTGATAACAC
CTACGGTTTG CCGGCTCAGT TAACTGACCT GTCAGAACCT CGCATGAATA AACAGAGTAT ATATTTTCAT CTTTGACTTC
TATCATTTGA TCCTCCTTTA CTATCATTTA TCAAGTAGCT TCTGTTGGTG CTAACTATCT TATTTATACA GGTGATCTTA
TTCCTGCTGC TGAACTTGTA TTCAAGAACT CTTCTGCCGT ATCTGTTGAA TTACCTGCAG TTGTTGCTTG CAAAACTGAT
GGTGCATCTG TACCACCAGC ACCTgcttgg gtttgttgtg atgattgcga aaaatggcgc tgcataccaa ctgaactggc
agataaaatc tcaaaagaaa atctcagatg gtattgattt ccatcctgcc atccctattt gatcaatttt cttggttgca
ccagtcctct aacctaattg agtaatcata cgctGAAATC TATTACTGCA TTGTTCCACT GGAAAATAAC TCATTTGAAA
TCCTTTTTGT TTGGATTTCC TTTTGTTTTG CTATGCTAGT CCACAATCAC CTATGTGAAA TAGAAAAGTT TGGTAAAATG
GAAAACATAT TTCTTTCTAA AGGAAGAAAG ACTTCTGACA CTATATTTAG ATAATCTGTA GAGTAAATCT TACATTTTGC
ATTTGTTTGT GCTCTATCAT TTTGGCAGTT GGCTAGCAGC CAGCCAGTTA CCCAGAGGAA GAAAGGTGCT TCTTGCATGT
TAGATGTGCC CATGTTCAAT ATTTCATATT AGTATTTCCT GTGCAAACAG AGGCTGTTCA ATTCTACAGT GTAACTACAG
ATATCTATTG CATTCCATTC CTTAAAATAT TCGTATTTCA TGGGCCTTTT TCATTTATGC TCATACTTTC CACGGGATTC
ATGTAGACTA TTAATGTATA TATGTAGAAG CATATCGTTT GACTTGAGAG GTGATGTCAT GGgatttgtc ttgcataata
ctttcataac agacagtttc catgtactat attgtaatga aaaacatggg caatattgca ttggagactg aaaagtgaaa
aatgacctgt gtttgtgaag tttgagaggg CAAAGATTAA CCTTATTACC AACATGTGGC TCCGCTACAT TGAAAATATA
TATTTTAATT CTTCCATTTG GTTTAATATT ATTGATCTTT TTGATGTAGA TGTCATTTCA GATGTGTTTG CCTACTCATT
TTGAATTTTT TCTTTATCTG TTGAATGGTT AATAAATTAC AACTCATTTT CCTTTCTTGT TTATACAAAG GACTTGTAAG
GAAAACGAAG ATAAGACATT TGCCAATTGC TCTATACCAC AAGAGAAGAC AGATGATGAG ATCAATGCAG AGCTTGGGCT
TTCAGATGCT TCTGCTGATG AAGCTAATGG CGATGGATCA AACTCGAAAG GTTTGAATTT TTGACTCTAT ACATTCTGGT
CAGAAAATGC AAAATTTTCT TTTGTTGCTC TCTATCATAT CTGATTTGTG ACAAACTTTT TCATATTGCT GTGTTGCAGC
TTCTGGAGAA CCAAACTTTG CACTTCTCAG GTCAAACTTG TTTCTACATC GTAACCGCAG GACACAATCC ATTGATGAGG
TATGGGTTGA TCTACTCACT TTTTATTTCT TAATTGACAT TCTTTTGTTT TCTGTTTGTT AAATTTACCT AGCATTATTT
TTTTCCGACC ATATTGCTTT TTATGTGCAA GGAGCAGTTA AGATTCATAT AGAGTTTTGT AGTTTATGTG TATTGTACTC
AGAACATGGT ATTGCAATAA ATCTTATGGG GGGTGAGCAT GCTACACATT GTTAGGCTCA GTTTGTGGTT GCTGTGCTGC
GCGCACTTGT TTTTTAAGTT CCCGTGGAAA TGAACTTATA ATTATTGTAG CTTATTCTAC AAATCGAATC ACAGTTAGAT
AAAATATGTT ATCCATCTGT CATGTTTTCC CAATTTTCAT ATTTTACATT ATAATATTAT CGTTTGCCAC ATGGATCAAA
ATAAAGGCAG TTTGCTCAAC ACCAAAATTC AAAAGCTCTA TCTGAAAACG AGATTATCAT AAGGCACCGC AATACCAAGA
TCAAAATAAA GGCAGTTTGC TCAACACCAA AATTCAAAAG TTCTTTCTGA AAACGAGATT ATCATAAGGC ACCGCAATAC
CAAACAGAGC TTTAGTTTCT CCACTTACCT CATAGTTTCA CTTCCCATGC CGCGTGTAGG ATAAGCTGGA AAAAACTGTT
ACTGAAGTGC CTATGTAAAG GCAGACAGTT GTATCATAGC CACTCCAAAT CAAGGATGGC CATGGTTCAC AAGTTTTCAG
TTACAGCAAA AATTCACAGT CAGTTTCACT TGCGCACATT TCCATTTCTC CCTTCTGCTA CAGCATGATT AGTGGAAGGT
GGAAACTGTT GTTCAGGACA AGTAAAATGC TCCCCATGGC CTCTCTCTCT CTCTCTCTCT CTCTCTCTCA TATTATTTAT
GTTTCTGCTC CCTCAACCTC TTGAATTTAT ATTATCTCCT TTTTATTTTC TATCAGTACT CCCTACAGCC CTgaaaatca
ttttggacat atccagtctt caaaatacaa ttttgaccac taatttctat tgtgatatat ttttaagtaa ttttcgagac
aaatctacac acatgattat attttttcat gcctccaatc taattattta aaaatttatc gatattcaat tttttgaaag
ttTGACAACA TGTCCGAAAG AACATGTTTA TGTGCCTGGA TGGAGTACAG GCTAAACTGT CTTGAACTGT TGTAGACAAC
TTATTATTTC TTTGTTCTTG GTTCTTTTGG GGGTTGAAAT TCCAGCAGAC AAACCTGATA TTTCTATTTT TTTTATTCAA
TAATGCAAGA GCATGGTATG CAATTGTAAG CCGCCTCACG ATGACCGAAT GGGTTGTAGA GATGGTTGCT TGAACAGGAT
ACTCAACATT GAATGCACCA AACGTACATG TCCATGTGGG GAGCACTGTT CCAATCAGCA GGTTAGATTC TTTCATATCC
TTGTTCTTGT TTCCTTACTA TGCTGGGTTT GAACTTATAA AGTTCTTGGA ACAGTTCCAA AGGCGCACCT ATGCAAAACT
TGGTAAGTTC CATACTGGTA AAAAGGGCTA TGGATTGCAA TTGAAGGAAG ATGTATCTGA AGGACGATTC CTCATTGAAT
ATGTTGGAGA GGTAGTGCTT CATGCTGCCT ATCGTCCCCC CTCCTCTGTT TATTCCGGGT TTGTGGTGGC GTTATATTTC
TGTTAGTGCA ACTTGCCCAT GGGAGCAATG TTTTATGTTG GCATGTCACT AAATAATACC TTGTATCTGT TGATTGCACT
GAGCCATTTG TGCATGCATG CATGTGTTGC CAACATGCTC TGTTTTCTTT TTTTTTTTTT GCAGGGAAAC ATGCTCTGTT
TAAATGTTGA TTATGTTGGT TTCACATTCG TTGTAATGAA TACCTTGTTC TGACATAGCC AGGATACTTA TCTCATTCTT
TTCACATGGA TATTGGTAAA AAAGCAAAAA GAATGAAGAG ATAATGATTC CATTAGTAGC ATCCTTCATT CCATGCATCT
ATTTTATATA GATATATTTT TAAACAACTG TAACTCTGAT ATTACTTCGT CGTGTTTCCG ACTTATGTAT TAAAAATATA
CTAGTATATA CAAATTCCAT TTTTATCCAA AACTGTACAA CCCTCTGGTA CAGAAATTCT GTGTATTTAT GCAATCTGCT
CTCTAACTCA ATTTCTCTTC TACTATTATG AATGACCTCA TGTCTAATGA GTTTGTTGAT TTGCTTACTT CATTGTTGTT
TCAGGTCCTT GATATAACGG CTTATGAATC CCGCCAAAGG TATTATGCCT CTAAAGGCCA GAAGCATTTC TATTTCATGG
CACTTAATGG TGGTGAGGTA TGTCTTTATT TATTCTTAAC CAGTCATATT GCATAGATGT ACTCCCTCAT TTCTAACTTC
ACGTCTTTCT CAATCCCTGC CACTTCTTAG ATATGCCTTC GATTAGAAAT TATCAGATTA GTTCATTTAT ATCATTTCCT
ATAATATCAA TAGATGATAC AAACAACCCA GTGTGGTATC TGTTTTTCTT ATGTCAACCT TCATGATGCT AACACTTAAA
ATTAAATCAG TTAATAGTTA ATACCACTTT TGGCATTTTG CTTTGAACTC TTCTAGGTGA TAGATGCTTG TACTAAAGGA
AACTTGGGCC GGTTCATCAA TCATAGCTGC AGTCCTAATT GCCGTACAGA GAAGGTAAAA CCGTTTTATT TGATCTTTAT
ATTTGAATAG CTGACCAGAT CCCTTGCCTT TGTTACTTAA AATATCCTGA TAATGTCCAA TACAAGTCAT ATGTTATATT
TACAAATAAA TAAATAAATA ATGATTGGTG CATAAAATTG TGTAATTAGT TATATTCTTA TTTTGAGTCC ATTAAATTAC
TTTTTCCTTG TGAGCAGTGG ATGGTCAATG GTGAAGTCTG CATTGGAATA TTTGCTATGA GGAACATCAA GAAGGTAAGG
CTAGAAACTT GAAATCATCA ATGAACATGA TGCAGGTCCT GAGAAACTGA GAGTTTGCTT TATACTAGCT AAATTTAAAT
ACCAACTTAA AATGTTGTAT ATTTTTTTGG GAAAAACATA TTAATTTGCA AAAAAAAGTC ATATAAAATA GCCTAGCCAC
ATGCAAAAGA CCCCAATTCA AGTGGTTATC TGATACACTG ACTACCACCA CCACCTTTCT TATTGTAGAG ATAATTTGTG
CAAATGAAAC GTATCCTTCA GTATAACCTA TATCTGTATT ATATGTGCTG CACTTAATGG ATATTTATTT CCTCACAGGG
TGAAGAATTG ACGTTTGATT ACAACTATGT TCGTGTATCT GGTGCTGCTC CTCAGAAATG CTTTTGCGGT ACTGCCAAAT
GCCGGGGTTA CATCGGTGGT GACATATCAG GTGCTGATAT GATTACTCAA GATGATGCTG AAGCAGGGAC TTTCGAACCT
ATGGCTGTTC AGGAGGATGC TGAGGAAGTA CTTGGTGCAA ATGGTTTGTC CTCTCATGGC ACACATCTAG ATATTGTCGA
CCATGAAGCT TCCACTAAAA CAGAAGATTC AAATGATTGC CCATCTGTGA ACCCACCAGA GTTAGAATCT GAGCAACAAA
CTTCAGGAAC CTTATTTGAC ACAAGTGAGC CAGAAAATTC CTTAGAAGCA TTGAGCCCAC AGGATGATGA AGATGTCGTC
CGCACACCTG TCCATGTGTC CCGGACAGTT GAGAGTACGT CGCGGCAGTT TCCAGAATAT GGTACTCGGT CATCAGAAAT
TTTGCAAAGG GCTCCATGCA CACTGGATGG ACCAAAGGTT CCAAGCACAA CAAATGGAAT TCCGCCTAGT TCCGATTTGG
GGAGCCACTG GGTACCAGGT TTCCACGCTA ATAAGAAAAC CAATGTAAAA CATCATTTGA TTCTGAATCC ATCATCAGCT
CCTATTGACA GTGAGCACAT TTTGGGAGGT AATACTGTTC TTCCAAGTGT ATCTCTCTTT CTGTCTAGGG TTACATATGA
CTGTTAATGA TCGCTACCTG ACATGCACAG TTGAAGGAAG ATTGAACAGC TTGCTTGATG TAAATGGAGG TATTAGCAAA
CGAAAAGTAT GTATCCTCTT GTCCTTTGCA TTATATATAT ACTTCAATTA TAGACTAGGA CTGAATATAT TTTACTGATT
TTTTGGCATC AACTCTTAAT TAGGATATGT TGTCATATGC TAAATGGCTA AAAATCAACC CAGTTTTTTT ATGAGGCATT
CTCTTACGGA GTTTGCACCG CGTTGGGGAT TAGGGAAACT TATATAGTGG TATTCCACAT TTCTTGAGCG CAAATGCTAA
AAGACAGTGT ATGAAATATG GATTAGTATT TCTCACATTT ATTAGTATCA ATCTCAAGAA CATAGTGTAT GAACGACTTT
CGATTGATTG AACTTCTACC TTTATTAGAC TTCTTTAGGT TTAAATTGTT TCTTGGTCAT CCTTTTTGGT ACACGGTGTG
GTTTGAACTT GAAAGGCTAG GCAATATTTG CATGTGTTCT GTGTTGCATC AATTGGGCGT CAAGCAGTCC AAATATCTCT
CCATTCTACC TTTTCTGTCA TTGGATATTA TTCTAACTAC TGATAATTTT TTTTTCCAAA AGGACGCAAC AAATGGATAC
TTGAAGCTTC TCCTTGTGAC TGCAGCGGAA GGTGACAATG CTGGGGGCAC GTCTAAAAGG TTTGATTACC TAATAACATC
CAGCAAGTTA CATTTGCCCA GTCTAAATAT GCTTCTGTTA TATCTTTCAG TGTAAGGGAT CTTTCGTTAA TTCTTGATGC
ACTTCTGAAA ACAAGATCCA ATTCTGTCCT GTTGGATATC ATCAATAAGA ATGGTACATT TTCTTGCATT CTGCAGCTTT
TTACGTGAAA TACAATCATC TAGAATTACT GACTAATAAA CTATTTGTAC TATTTTCTGA CAGGACTGCA AATGCTTCAC
AATATATTAA AGCAGAATAA AAGCGATTTC CATAGGATAC CTATAATAAG AAAGCTTGTG AAGGTTTGCA TTTCTTTTTT
ATGTTATGTC TTATTACATT AGTTTCCAAT TAATATATCA CATTAGAGCA AGTACATCCC TTAACAACTG ATCTAGGTGC
TACAGTGGAC ATATCAACCC CCACAAGATC CTTGTTATCT ACTCCCTCTG ATTCTTTTAT GACTTGTGCA CAAAAATCAA
GAAAAAAAAA CTCAAAATGA CTATTGTCCT TCATTTATGC TGCACTGGAA AAGATGATAA TGTATTTTGT GAGATGGTGG
CATTTATTTG GCAAGGGCAA ACAAG

Locus: Os02g0554000

Loading...

Locus: Os02g0554000

Loading...