Os02t0554000-02

Locus

Os02g0554000

Description

H3K36 methyltransferase, SET domain group (SDG) protein 725, Brassinosteroid-regulated plant growth and development, Promotion of flowering

RAP-DB Gene Symbol Synonym(s)

SDG725

RAP-DB Gene Name Synonym(s)

SET domain group 725

CGSNL Gene Symbol

SDG725

CGSNL Gene Name

SET DOMAIN GROUP PROTEIN 725

Oryzabase Gene Symbol Synonym(s)

OsSDG725, OsSET8, ASHH2

Oryzabase Gene Name Synonym(s)

SET Domain Group Protein725, SET DOMAIN GROUP725, SET protein 8, "ABSENT, SMALL, OR HOMEOTIC DISCS 1 HOMOLOG 2"

Transcript Evidence

AK106534 (truncated)

AK287667 (truncated)

XM_015769943.2

Inferred from literature

Protein Evidence

XP_015625429 (RefSeq)

Literature

PMID: 22136623

PMID: 23239829

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

December 3, 2021

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Zinc finger, CW-type (IPR011124)

AWS domain (IPR006560)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-108-B04(truncated) (Online Clone Ordering)

J065117I11(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os02t0554000-02)

Others

Oryzabase (11165)

Transcript

7159 bp

>Os02t0554000-02 H3K36 methyltransferase, SET domain group (SDG) protein 725, Brassinosteroid-regulated plant growth and development, Promotion of flowering
CCTCTTCCCCCCTTCTCTCTCTCTTCCTCCCTATCCGCCTCCTTCTCCGCCGCCTCCTCC
CCGCAACGACGCGGCGACTACGACGACCCGACTCGCCGCCTCCTCGCCCCCCGCCGCCGC
GGCGCGCGTACGGACGGGCGGCGGGCCCCTCCTCGCCGGGCGCCGGGGTCCGCAGGCATT
CGCCGCCGCCGCCGTAGTGTGGCTTCGTTTGAGGGGCTCGCGAATTCTAGGGTTTTTTTT
TGGGTGTGATCGGAGGTGGGGAGAAGCGGCGAGGACGCGGGGGGAGGGGAGGTGGGGGGG
CGTGCATTGGATGGTCTCGATCCGTGCGGCTCCCCGCTGACACGCTGCTTCGATGGAGGA
GCCTGACGGGGAAGCGCGTGGGCGGGAGGATCATGCTGCGGTTGGGCGGTTGGGAGGAGA
GGAGGGTGCTGTTGGCGGCGGTGGCCTGGCTTTGCTCGCTGTTCCTGAGATTGGCGGTGA
GCTCGGTGATGGTGGGAAGGTCTGCGGTGGTCAGGAGAGGCGCCTGCCCACAGAGGAAGA
TGGAGTCCGAGATAATGGAGGTGGCTCCGCTGCAGAATTGGTGGAATCTGCTGTGAATGT
TTCTACCCCTTTTGAAGGAAGGGGTCAGATTGGTGGTGAGAAGGAGTCTAGTATGCAGGA
GGGGTCTATGAACATGGCGGGAGAGAAGCATGGCAGTTATCATGTGGAATCTGCTGAACC
CAGCAATTTGCAGACGTGTCATGCGCCCAATGGCGGGGTATCGAATAAGACATTATTTGC
TCCCTTCAGCGAAGTTTTCTCCAGTGATAACAGCCATATGCGTTACTTGCTGGACAAAGC
GACAGAGGGGAGCATTTGTGAGCATGGTGATTTGGCGGACAGTAAAGATGATTTGGGTGG
CGCAACGGACGTAAAGACAAACACAGAAGATTTACAGATGGTTTGCACGAAACCACATTG
TGATAGCGAGGGTTTGTCGGATTTGCATAATGACAGTGAGCGATGGCCACAAGTGGTTGA
TGGGGTGGGATTTACGATAAAGGGTAATAATGAGCTGAAACAAGTTGATTTGATACCAAA
AATTGAAGCTGAAGTCTCTAGGTCGGTGGAGGATGATTCAATCCCTTCTTTTTCTGGTGG
TATTGATGATTCTTTACGCAAGGCAGGTTGTGCGTGTGAAACTCTCAATGATATGGGGAT
GTCTCATATGGCCAATGGTGATTTGTGGTGCAATGTTTTATATGCCCCTCTTAGTGAAGG
ATGCCAGTCCAAGGATGCTCGACACATAGCAGTCATGGGGAACAAGGTGACACAGGGGAG
TCAATGCGGGCAGGGTGATTTGGCGTGTGATGGAATTGTTTTGCGAGGTGGGGTAGATGT
AGAGAAAAGTCTAGATGATTTACAGATGTGTTCCAAGGAACCACAATGTGATAACAAGGG
CTTTCCATATTTGACAGAATTTGGTGTCCAGCAGCCATCATATGGCATGAATGTCATATG
TTCGAAGACAGATCCTAACCATCAGCTGGAAAAGGATGAATTGTTGACAAATACTAGAGG
AGAGTTCTCTAGTTCTATCCATGAGGATTCAGTTCCTTCAATTTCTGTGAGCTCTGTTGA
TTTTACTTTTGATGGCAATGCTGGTCAGATTGGTAAAACATCTGAGCATAGAGCAATCAT
GGAGAAAGTGTCGCATGGTTCACAGCGAGGAGGTGTACTTTCCTGTGAGAGTAGGTCTTT
AAAGGAGTCTCATGCAGATGAGAATCAGAGTTCCACATTGGAGGTTAAGACATGTGAAGA
GGGCTTACAGACAGGTCAAGTGGAACCATGCCACAGCATCGTAGCTTTGTCGGATTCAGG
GAAGTATGGCACCGACATATTACCACGTGGTGGTGACGGTCTGAGATCGATGACTGGTGC
TAACCATGAGCTGGTAAAGGATGATTTTCATCCAAAAAGTGATGTAGTGGTCTCCTGTCC
AGTGGATGAGGCATCGATTCCCTCTAACTATAATAGCCCCATTGATGTTCTTTTATACAA
AGAGGATGGTTTAGTTGGTGAGATATCTGAAAATAGAATTGGTGTGGAGAAATTGGCTCA
TGATTTGCTCGGAGAAGTTATGCTTTCATTTGACAGCAGGCCTCAGACTGAGGCTTCTGG
AGATGAGAATCAACACTTCTGGATGGATGTTCCAAAGGGTTCAACTGCATCTGTTTGTGA
AGTAGAAAATACAGGCACTAGAAGATCTTGTGATCCCTGTGCTGAAATAGAGTTTCCACT
CCAACAAAGTCGTGAAAAGCATGTGATCTCTGAATCCCCCCCAGAGAGAGATCTGACTAG
TTCGTCCCATAACCTACCTTGTGAAAATGAACCTTGTTATAGTGGCAGGGAAACACCCGC
CTTCTGCCTAGGCCATCAAGATTCTGCTGGTCTTGGACTGGAATCTTCAGACTGTTTGGT
ACAAGAGCTCAATACGTGTACTTCCACTGATGACAAAGCTTGCTCTGTTGATTTTGTTGA
GAATGGTAATGGTTCTCATAACCAAAAGGAAGTGCCGGTGATTTTCTTCAGGCGGAGGAA
TCCAGTAAGAGCTGCCTCTTCAAGAAATTCTAATTTTGAGAAGTGTGACCAGATAAACAA
ATCAGGTAATAGTACACGCAAATCTAAGAAGGTTGACAGTGTAAGCTCATTACTTAAAAG
CACCATGATTAAGTTCCCAAACAAAACCACAAAGGGAAGAAGTGGCATCAATAGGCCATT
GAACTCTTCTGCTTGGGGCAGCCTACAAAAGCTAATGGATGGTTTCAATCAGAACTGTGG
TCCTTCAACTTCTCGTTCTCATCAAACTTGTTTGGGAAAAGAAATATCAAATAGAGGATC
TAGCGAGAAAAAACAGCTATCTATTCGGAAAATTCGAACTTCAAGATGTTCAAAATATAA
AAACACATCACTTTCTGATATTGGATATTTAGCAGGTGAATTGAATGGCCAACCGACCTG
TTCAGTGAGGATTGATACTAATGTTTCTTCTGATGCATTGTTCAATTCTCCGAATGGTGC
TCACAAAGCTGCACAGTGTGTTGAAGGTAATCATACTCTAAAATTAACATCTAGCCTGAC
TGACACACAACAGTTTGGCTTGGAGAATGTTACTCAAGAAACATGCCCTGGGTACATCCA
TGGAGAGTGTGGTACTTCAACTTCTGAACGTTCTCTAAATAATATAGTTGGGTTTTCACC
AGACTCTGTTTTGGATATAGCTTCTGTTACATGTGAAAGCAACACTTCTGCAACCCTTGA
TGTTATAGTGCATGAAAACCCATCTTGTCCTGGTGGATTGATTGGAGGTGGTCTTCGTGC
ATCTGCTTTATCTACTTCTCACTGTGAAAATCATCATGCTTCATCATTGATGGATTTGGA
GCAGCAGGTCAAAACTGTGAGGGAGAACGACATGGGAGAGGAAGATGTCATTCCATCACA
TGCCATGATGTACAATGATATTGGTGAAGGAAAGCAAACTTTAGCGAAGTCCAATACGAT
GAGGAAAGGTAGAAATGTGGGAAAGCAGGAATGCCGAAAGAAAGATGGAAAGAAGGGAAA
AAACATAAACAAAAATAGAAGTTCCACCAAAATTTCATCTAGTGAAGCTTCAAAACTCGT
GTCCTTTTCTAATGATTCACCTTCACTTGATCCATCTGAGTTGCTGCTTCATACGAGACC
TCCAAAGTTTGGTTCTTGTTCTAAGGTCGTAACTTCTGCCATACATGATGTTGGTATGCA
TGGATATGACAATATGCGTCCTTTTGGAATTGACAATGATGACGAAGGGAGTGCATTTGA
CAATGTGAAATCACTAAGGCGCAAGAAAAAGGATAGTCATGGAGGAAAGAAGGGTAAGGT
GCGGGATCCACATGGGAAGGGCAGAAGCAAGAAGAAAAATATAGCTGATAACACCTACGG
TTTGCCGGCTCAGTTAACTGACCTGTCAGAACCTCGCATGAATAAACAGAGTGATCTTAT
TCCTGCTGCTGAACTTGTATTCAAGAACTCTTCTGCCGTATCTGTTGAATTACCTGCAGT
TGTTGCTTGCAAAACTGATGGTGCATCTGTACCACCAGCACCTgcttgggtttgttgtga
tgattgcgaaaaatggcgctgcataccaactgaactggcagataaaatctcaaaagaaaa
tctcagatgGACTTGTAAGGAAAACGAAGATAAGACATTTGCCAATTGCTCTATACCACA
AGAGAAGACAGATGATGAGATCAATGCAGAGCTTGGGCTTTCAGATGCTTCTGCTGATGA
AGCTAATGGCGATGGATCAAACTCGAAAGCTTCTGGAGAACCAAACTTTGCACTTCTCAG
GTCAAACTTGTTTCTACATCGTAACCGCAGGACACAATCCATTGATGAGAGCATGGTATG
CAATTGTAAGCCGCCTCACGATGACCGAATGGGTTGTAGAGATGGTTGCTTGAACAGGAT
ACTCAACATTGAATGCACCAAACGTACATGTCCATGTGGGGAGCACTGTTCCAATCAGCA
GTTCCAAAGGCGCACCTATGCAAAACTTGGTAAGTTCCATACTGGTAAAAAGGGCTATGG
ATTGCAATTGAAGGAAGATGTATCTGAAGGACGATTCCTCATTGAATATGTTGGAGAGGT
CCTTGATATAACGGCTTATGAATCCCGCCAAAGGTATTATGCCTCTAAAGGCCAGAAGCA
TTTCTATTTCATGGCACTTAATGGTGGTGAGGTGATAGATGCTTGTACTAAAGGAAACTT
GGGCCGGTTCATCAATCATAGCTGCAGTCCTAATTGCCGTACAGAGAAGTGGATGGTCAA
TGGTGAAGTCTGCATTGGAATATTTGCTATGAGGAACATCAAGAAGGGTGAAGAATTGAC
GTTTGATTACAACTATGTTCGTGTATCTGGTGCTGCTCCTCAGAAATGCTTTTGCGGTAC
TGCCAAATGCCGGGGTTACATCGGTGGTGACATATCAGGTGCTGATATGATTACTCAAGA
TGATGCTGAAGCAGGGACTTTCGAACCTATGGCTGTTCAGGAGGATGCTGAGGAAGTACT
TGGTGCAAATGGTTTGTCCTCTCATGGCACACATCTAGATATTGTCGACCATGAAGCTTC
CACTAAAACAGAAGATTCAAATGATTGCCCATCTGTGAACCCACCAGAGTTAGAATCTGA
GCAACAAACTTCAGGAACCTTATTTGACACAAGTGAGCCAGAAAATTCCTTAGAAGCATT
GAGCCCACAGGATGATGAAGATGTCGTCCGCACACCTGTCCATGTGTCCCGGACAGTTGA
GAGTACGTCGCGGCAGTTTCCAGAATATGGTACTCGGTCATCAGAAATTTTGCAAAGGGC
TCCATGCACACTGGATGGACCAAAGGTTCCAAGCACAACAAATGGAATTCCGCCTAGTTC
CGATTTGGGGAGCCACTGGGTACCAGGTTTCCACGCTAATAAGAAAACCAATGTAAAACA
TCATTTGATTCTGAATCCATCATCAGCTCCTATTGACAGTGAGCACATTTTGGGAGTTGA
AGGAAGATTGAACAGCTTGCTTGATGTAAATGGAGGTATTAGCAAACGAAAAGACGCAAC
AAATGGATACTTGAAGCTTCTCCTTGTGACTGCAGCGGAAGGTGACAATGCTGGGGGCAC
GTCTAAAAGTGTAAGGGATCTTTCGTTAATTCTTGATGCACTTCTGAAAACAAGATCCAA
TTCTGTCCTGTTGGATATCATCAATAAGAATGGACTGCAAATGCTTCACAATATATTAAA
GCAGAATAAAAGCGATTTCCATAGGATACCTATAATAAGAAAGCTTGTGAAGGTACTTGA
GTTTCTAGCTTCCAAGGGCATTCTGACATCTGAACATATAAATGGTGGTCCTCGATGTGC
TGGGACAGAAAGCTTCAGGGAGTCGATGTTGGGCTTGTTAAGGCATAATGATATGCAGGT
TCAACAGATTGCTCGGAACTTTCGTGATAGATGGATCCAATGGGCCCCTCGAAATATTTC
AAGAAATGAGCCAACAGAATATTCACGTGCATCCATATCTGCACACGATATTCATGTCAT
TTCAACAGCTGGTGGATCTTTTCCAACTTCAGCCAACACTATGGATTGGAAATCCATCAG
AAGAAAACGCAAGAGCCGTTGGGATTACCAACCAGATGACCACTATAAAATGGGTGGCCT
GAAAATTCAGAAAGTTTGTCCTGTACAAAGTGAGTTTCGGACTGGCTCGGTGGGAAATAA
GTTGCATGGTAATTGGGGAACGAACAGCTCCCACAATGATGTTCCTGTGGTGGGAAGTTC
AGCCGATGGTGCAGATGATGAAGCACCTCCTGGATTTGAGTCTCAGCAGGAAAGTCGGCC
TGGACAAGCTTGTTTAGAATCGGGGGTTTCTCCAGGATTATACTTGGAGAGGTATCAACA
TAACTTGACTATTTCATACGGGATTCCAATCGCTTTTGTTGAGCATTTTGGAACCCCAGA
AGTTGAAGGAGGGCCATGTCGCAAAAACTGGAAAGTCGCACCTGGTGTGCCTTTCCAGCC
CTTTCCACCATTGCCGCCCTATCCAAGAGGGAGTCCTTGTCCTTCCACTCAGATGTCTCA
GCATGAACACAACAGTTTGGGACATTGTGGCAGGGCTGCAAATAGAGACGGGAGAATACA
TAGGAATTGGAGAAATGGGGCGAGAACAAAATTTCCATACAATCATCAAGGACGGAGATT
TCCTAACAATAATCAAAGATTTTGAAAGTTGCCTGCTGCCTCCAACGTCTCAGGAGCAGG
GTGATCCAGGACCTAGAGGCAGGGAGTGACCCAAGTCCTGGTTTTTGAACCTCAAATAGT
GGTTTATACATTGTAGTTCCTGTTTATCAGAGCCCCAGAGGTGTATCAGAATTGCGTGCG
CCCGTAATTCTATTTAATAGGAGCAGATGTTACTGTCAGTTTATTAGAGGTAGAAACATA
TTCTGCAAATAGGTCATTGCCTTTGCGGTTCTTTTACTAATTAATTTGCCCATTGGCTCC
CTCTGCGCTATGTGTAATCCCGATAGGAATAATTGATTTGATTCAAATCGTTTTACAGGC
AAAATGGCTAATTGGTTTC

CDS

6453 bp

>Os02t0554000-02 H3K36 methyltransferase, SET domain group (SDG) protein 725, Brassinosteroid-regulated plant growth and development, Promotion of flowering
ATGGAGGAGCCTGACGGGGAAGCGCGTGGGCGGGAGGATCATGCTGCGGTTGGGCGGTTG
GGAGGAGAGGAGGGTGCTGTTGGCGGCGGTGGCCTGGCTTTGCTCGCTGTTCCTGAGATT
GGCGGTGAGCTCGGTGATGGTGGGAAGGTCTGCGGTGGTCAGGAGAGGCGCCTGCCCACA
GAGGAAGATGGAGTCCGAGATAATGGAGGTGGCTCCGCTGCAGAATTGGTGGAATCTGCT
GTGAATGTTTCTACCCCTTTTGAAGGAAGGGGTCAGATTGGTGGTGAGAAGGAGTCTAGT
ATGCAGGAGGGGTCTATGAACATGGCGGGAGAGAAGCATGGCAGTTATCATGTGGAATCT
GCTGAACCCAGCAATTTGCAGACGTGTCATGCGCCCAATGGCGGGGTATCGAATAAGACA
TTATTTGCTCCCTTCAGCGAAGTTTTCTCCAGTGATAACAGCCATATGCGTTACTTGCTG
GACAAAGCGACAGAGGGGAGCATTTGTGAGCATGGTGATTTGGCGGACAGTAAAGATGAT
TTGGGTGGCGCAACGGACGTAAAGACAAACACAGAAGATTTACAGATGGTTTGCACGAAA
CCACATTGTGATAGCGAGGGTTTGTCGGATTTGCATAATGACAGTGAGCGATGGCCACAA
GTGGTTGATGGGGTGGGATTTACGATAAAGGGTAATAATGAGCTGAAACAAGTTGATTTG
ATACCAAAAATTGAAGCTGAAGTCTCTAGGTCGGTGGAGGATGATTCAATCCCTTCTTTT
TCTGGTGGTATTGATGATTCTTTACGCAAGGCAGGTTGTGCGTGTGAAACTCTCAATGAT
ATGGGGATGTCTCATATGGCCAATGGTGATTTGTGGTGCAATGTTTTATATGCCCCTCTT
AGTGAAGGATGCCAGTCCAAGGATGCTCGACACATAGCAGTCATGGGGAACAAGGTGACA
CAGGGGAGTCAATGCGGGCAGGGTGATTTGGCGTGTGATGGAATTGTTTTGCGAGGTGGG
GTAGATGTAGAGAAAAGTCTAGATGATTTACAGATGTGTTCCAAGGAACCACAATGTGAT
AACAAGGGCTTTCCATATTTGACAGAATTTGGTGTCCAGCAGCCATCATATGGCATGAAT
GTCATATGTTCGAAGACAGATCCTAACCATCAGCTGGAAAAGGATGAATTGTTGACAAAT
ACTAGAGGAGAGTTCTCTAGTTCTATCCATGAGGATTCAGTTCCTTCAATTTCTGTGAGC
TCTGTTGATTTTACTTTTGATGGCAATGCTGGTCAGATTGGTAAAACATCTGAGCATAGA
GCAATCATGGAGAAAGTGTCGCATGGTTCACAGCGAGGAGGTGTACTTTCCTGTGAGAGT
AGGTCTTTAAAGGAGTCTCATGCAGATGAGAATCAGAGTTCCACATTGGAGGTTAAGACA
TGTGAAGAGGGCTTACAGACAGGTCAAGTGGAACCATGCCACAGCATCGTAGCTTTGTCG
GATTCAGGGAAGTATGGCACCGACATATTACCACGTGGTGGTGACGGTCTGAGATCGATG
ACTGGTGCTAACCATGAGCTGGTAAAGGATGATTTTCATCCAAAAAGTGATGTAGTGGTC
TCCTGTCCAGTGGATGAGGCATCGATTCCCTCTAACTATAATAGCCCCATTGATGTTCTT
TTATACAAAGAGGATGGTTTAGTTGGTGAGATATCTGAAAATAGAATTGGTGTGGAGAAA
TTGGCTCATGATTTGCTCGGAGAAGTTATGCTTTCATTTGACAGCAGGCCTCAGACTGAG
GCTTCTGGAGATGAGAATCAACACTTCTGGATGGATGTTCCAAAGGGTTCAACTGCATCT
GTTTGTGAAGTAGAAAATACAGGCACTAGAAGATCTTGTGATCCCTGTGCTGAAATAGAG
TTTCCACTCCAACAAAGTCGTGAAAAGCATGTGATCTCTGAATCCCCCCCAGAGAGAGAT
CTGACTAGTTCGTCCCATAACCTACCTTGTGAAAATGAACCTTGTTATAGTGGCAGGGAA
ACACCCGCCTTCTGCCTAGGCCATCAAGATTCTGCTGGTCTTGGACTGGAATCTTCAGAC
TGTTTGGTACAAGAGCTCAATACGTGTACTTCCACTGATGACAAAGCTTGCTCTGTTGAT
TTTGTTGAGAATGGTAATGGTTCTCATAACCAAAAGGAAGTGCCGGTGATTTTCTTCAGG
CGGAGGAATCCAGTAAGAGCTGCCTCTTCAAGAAATTCTAATTTTGAGAAGTGTGACCAG
ATAAACAAATCAGGTAATAGTACACGCAAATCTAAGAAGGTTGACAGTGTAAGCTCATTA
CTTAAAAGCACCATGATTAAGTTCCCAAACAAAACCACAAAGGGAAGAAGTGGCATCAAT
AGGCCATTGAACTCTTCTGCTTGGGGCAGCCTACAAAAGCTAATGGATGGTTTCAATCAG
AACTGTGGTCCTTCAACTTCTCGTTCTCATCAAACTTGTTTGGGAAAAGAAATATCAAAT
AGAGGATCTAGCGAGAAAAAACAGCTATCTATTCGGAAAATTCGAACTTCAAGATGTTCA
AAATATAAAAACACATCACTTTCTGATATTGGATATTTAGCAGGTGAATTGAATGGCCAA
CCGACCTGTTCAGTGAGGATTGATACTAATGTTTCTTCTGATGCATTGTTCAATTCTCCG
AATGGTGCTCACAAAGCTGCACAGTGTGTTGAAGGTAATCATACTCTAAAATTAACATCT
AGCCTGACTGACACACAACAGTTTGGCTTGGAGAATGTTACTCAAGAAACATGCCCTGGG
TACATCCATGGAGAGTGTGGTACTTCAACTTCTGAACGTTCTCTAAATAATATAGTTGGG
TTTTCACCAGACTCTGTTTTGGATATAGCTTCTGTTACATGTGAAAGCAACACTTCTGCA
ACCCTTGATGTTATAGTGCATGAAAACCCATCTTGTCCTGGTGGATTGATTGGAGGTGGT
CTTCGTGCATCTGCTTTATCTACTTCTCACTGTGAAAATCATCATGCTTCATCATTGATG
GATTTGGAGCAGCAGGTCAAAACTGTGAGGGAGAACGACATGGGAGAGGAAGATGTCATT
CCATCACATGCCATGATGTACAATGATATTGGTGAAGGAAAGCAAACTTTAGCGAAGTCC
AATACGATGAGGAAAGGTAGAAATGTGGGAAAGCAGGAATGCCGAAAGAAAGATGGAAAG
AAGGGAAAAAACATAAACAAAAATAGAAGTTCCACCAAAATTTCATCTAGTGAAGCTTCA
AAACTCGTGTCCTTTTCTAATGATTCACCTTCACTTGATCCATCTGAGTTGCTGCTTCAT
ACGAGACCTCCAAAGTTTGGTTCTTGTTCTAAGGTCGTAACTTCTGCCATACATGATGTT
GGTATGCATGGATATGACAATATGCGTCCTTTTGGAATTGACAATGATGACGAAGGGAGT
GCATTTGACAATGTGAAATCACTAAGGCGCAAGAAAAAGGATAGTCATGGAGGAAAGAAG
GGTAAGGTGCGGGATCCACATGGGAAGGGCAGAAGCAAGAAGAAAAATATAGCTGATAAC
ACCTACGGTTTGCCGGCTCAGTTAACTGACCTGTCAGAACCTCGCATGAATAAACAGAGT
GATCTTATTCCTGCTGCTGAACTTGTATTCAAGAACTCTTCTGCCGTATCTGTTGAATTA
CCTGCAGTTGTTGCTTGCAAAACTGATGGTGCATCTGTACCACCAGCACCTgcttgggtt
tgttgtgatgattgcgaaaaatggcgctgcataccaactgaactggcagataaaatctca
aaagaaaatctcagatgGACTTGTAAGGAAAACGAAGATAAGACATTTGCCAATTGCTCT
ATACCACAAGAGAAGACAGATGATGAGATCAATGCAGAGCTTGGGCTTTCAGATGCTTCT
GCTGATGAAGCTAATGGCGATGGATCAAACTCGAAAGCTTCTGGAGAACCAAACTTTGCA
CTTCTCAGGTCAAACTTGTTTCTACATCGTAACCGCAGGACACAATCCATTGATGAGAGC
ATGGTATGCAATTGTAAGCCGCCTCACGATGACCGAATGGGTTGTAGAGATGGTTGCTTG
AACAGGATACTCAACATTGAATGCACCAAACGTACATGTCCATGTGGGGAGCACTGTTCC
AATCAGCAGTTCCAAAGGCGCACCTATGCAAAACTTGGTAAGTTCCATACTGGTAAAAAG
GGCTATGGATTGCAATTGAAGGAAGATGTATCTGAAGGACGATTCCTCATTGAATATGTT
GGAGAGGTCCTTGATATAACGGCTTATGAATCCCGCCAAAGGTATTATGCCTCTAAAGGC
CAGAAGCATTTCTATTTCATGGCACTTAATGGTGGTGAGGTGATAGATGCTTGTACTAAA
GGAAACTTGGGCCGGTTCATCAATCATAGCTGCAGTCCTAATTGCCGTACAGAGAAGTGG
ATGGTCAATGGTGAAGTCTGCATTGGAATATTTGCTATGAGGAACATCAAGAAGGGTGAA
GAATTGACGTTTGATTACAACTATGTTCGTGTATCTGGTGCTGCTCCTCAGAAATGCTTT
TGCGGTACTGCCAAATGCCGGGGTTACATCGGTGGTGACATATCAGGTGCTGATATGATT
ACTCAAGATGATGCTGAAGCAGGGACTTTCGAACCTATGGCTGTTCAGGAGGATGCTGAG
GAAGTACTTGGTGCAAATGGTTTGTCCTCTCATGGCACACATCTAGATATTGTCGACCAT
GAAGCTTCCACTAAAACAGAAGATTCAAATGATTGCCCATCTGTGAACCCACCAGAGTTA
GAATCTGAGCAACAAACTTCAGGAACCTTATTTGACACAAGTGAGCCAGAAAATTCCTTA
GAAGCATTGAGCCCACAGGATGATGAAGATGTCGTCCGCACACCTGTCCATGTGTCCCGG
ACAGTTGAGAGTACGTCGCGGCAGTTTCCAGAATATGGTACTCGGTCATCAGAAATTTTG
CAAAGGGCTCCATGCACACTGGATGGACCAAAGGTTCCAAGCACAACAAATGGAATTCCG
CCTAGTTCCGATTTGGGGAGCCACTGGGTACCAGGTTTCCACGCTAATAAGAAAACCAAT
GTAAAACATCATTTGATTCTGAATCCATCATCAGCTCCTATTGACAGTGAGCACATTTTG
GGAGTTGAAGGAAGATTGAACAGCTTGCTTGATGTAAATGGAGGTATTAGCAAACGAAAA
GACGCAACAAATGGATACTTGAAGCTTCTCCTTGTGACTGCAGCGGAAGGTGACAATGCT
GGGGGCACGTCTAAAAGTGTAAGGGATCTTTCGTTAATTCTTGATGCACTTCTGAAAACA
AGATCCAATTCTGTCCTGTTGGATATCATCAATAAGAATGGACTGCAAATGCTTCACAAT
ATATTAAAGCAGAATAAAAGCGATTTCCATAGGATACCTATAATAAGAAAGCTTGTGAAG
GTACTTGAGTTTCTAGCTTCCAAGGGCATTCTGACATCTGAACATATAAATGGTGGTCCT
CGATGTGCTGGGACAGAAAGCTTCAGGGAGTCGATGTTGGGCTTGTTAAGGCATAATGAT
ATGCAGGTTCAACAGATTGCTCGGAACTTTCGTGATAGATGGATCCAATGGGCCCCTCGA
AATATTTCAAGAAATGAGCCAACAGAATATTCACGTGCATCCATATCTGCACACGATATT
CATGTCATTTCAACAGCTGGTGGATCTTTTCCAACTTCAGCCAACACTATGGATTGGAAA
TCCATCAGAAGAAAACGCAAGAGCCGTTGGGATTACCAACCAGATGACCACTATAAAATG
GGTGGCCTGAAAATTCAGAAAGTTTGTCCTGTACAAAGTGAGTTTCGGACTGGCTCGGTG
GGAAATAAGTTGCATGGTAATTGGGGAACGAACAGCTCCCACAATGATGTTCCTGTGGTG
GGAAGTTCAGCCGATGGTGCAGATGATGAAGCACCTCCTGGATTTGAGTCTCAGCAGGAA
AGTCGGCCTGGACAAGCTTGTTTAGAATCGGGGGTTTCTCCAGGATTATACTTGGAGAGG
TATCAACATAACTTGACTATTTCATACGGGATTCCAATCGCTTTTGTTGAGCATTTTGGA
ACCCCAGAAGTTGAAGGAGGGCCATGTCGCAAAAACTGGAAAGTCGCACCTGGTGTGCCT
TTCCAGCCCTTTCCACCATTGCCGCCCTATCCAAGAGGGAGTCCTTGTCCTTCCACTCAG
ATGTCTCAGCATGAACACAACAGTTTGGGACATTGTGGCAGGGCTGCAAATAGAGACGGG
AGAATACATAGGAATTGGAGAAATGGGGCGAGAACAAAATTTCCATACAATCATCAAGGA
CGGAGATTTCCTAACAATAATCAAAGATTTTGA

Protein

2150 aa

>Os02t0554000-02 H3K36 methyltransferase, SET domain group (SDG) protein 725, Brassinosteroid-regulated plant growth and development, Promotion of flowering
MEEPDGEARGREDHAAVGRLGGEEGAVGGGGLALLAVPEIGGELGDGGKVCGGQERRLPT
EEDGVRDNGGGSAAELVESAVNVSTPFEGRGQIGGEKESSMQEGSMNMAGEKHGSYHVES
AEPSNLQTCHAPNGGVSNKTLFAPFSEVFSSDNSHMRYLLDKATEGSICEHGDLADSKDD
LGGATDVKTNTEDLQMVCTKPHCDSEGLSDLHNDSERWPQVVDGVGFTIKGNNELKQVDL
IPKIEAEVSRSVEDDSIPSFSGGIDDSLRKAGCACETLNDMGMSHMANGDLWCNVLYAPL
SEGCQSKDARHIAVMGNKVTQGSQCGQGDLACDGIVLRGGVDVEKSLDDLQMCSKEPQCD
NKGFPYLTEFGVQQPSYGMNVICSKTDPNHQLEKDELLTNTRGEFSSSIHEDSVPSISVS
SVDFTFDGNAGQIGKTSEHRAIMEKVSHGSQRGGVLSCESRSLKESHADENQSSTLEVKT
CEEGLQTGQVEPCHSIVALSDSGKYGTDILPRGGDGLRSMTGANHELVKDDFHPKSDVVV
SCPVDEASIPSNYNSPIDVLLYKEDGLVGEISENRIGVEKLAHDLLGEVMLSFDSRPQTE
ASGDENQHFWMDVPKGSTASVCEVENTGTRRSCDPCAEIEFPLQQSREKHVISESPPERD
LTSSSHNLPCENEPCYSGRETPAFCLGHQDSAGLGLESSDCLVQELNTCTSTDDKACSVD
FVENGNGSHNQKEVPVIFFRRRNPVRAASSRNSNFEKCDQINKSGNSTRKSKKVDSVSSL
LKSTMIKFPNKTTKGRSGINRPLNSSAWGSLQKLMDGFNQNCGPSTSRSHQTCLGKEISN
RGSSEKKQLSIRKIRTSRCSKYKNTSLSDIGYLAGELNGQPTCSVRIDTNVSSDALFNSP
NGAHKAAQCVEGNHTLKLTSSLTDTQQFGLENVTQETCPGYIHGECGTSTSERSLNNIVG
FSPDSVLDIASVTCESNTSATLDVIVHENPSCPGGLIGGGLRASALSTSHCENHHASSLM
DLEQQVKTVRENDMGEEDVIPSHAMMYNDIGEGKQTLAKSNTMRKGRNVGKQECRKKDGK
KGKNINKNRSSTKISSSEASKLVSFSNDSPSLDPSELLLHTRPPKFGSCSKVVTSAIHDV
GMHGYDNMRPFGIDNDDEGSAFDNVKSLRRKKKDSHGGKKGKVRDPHGKGRSKKKNIADN
TYGLPAQLTDLSEPRMNKQSDLIPAAELVFKNSSAVSVELPAVVACKTDGASVPPAPAWV
CCDDCEKWRCIPTELADKISKENLRWTCKENEDKTFANCSIPQEKTDDEINAELGLSDAS
ADEANGDGSNSKASGEPNFALLRSNLFLHRNRRTQSIDESMVCNCKPPHDDRMGCRDGCL
NRILNIECTKRTCPCGEHCSNQQFQRRTYAKLGKFHTGKKGYGLQLKEDVSEGRFLIEYV
GEVLDITAYESRQRYYASKGQKHFYFMALNGGEVIDACTKGNLGRFINHSCSPNCRTEKW
MVNGEVCIGIFAMRNIKKGEELTFDYNYVRVSGAAPQKCFCGTAKCRGYIGGDISGADMI
TQDDAEAGTFEPMAVQEDAEEVLGANGLSSHGTHLDIVDHEASTKTEDSNDCPSVNPPEL
ESEQQTSGTLFDTSEPENSLEALSPQDDEDVVRTPVHVSRTVESTSRQFPEYGTRSSEIL
QRAPCTLDGPKVPSTTNGIPPSSDLGSHWVPGFHANKKTNVKHHLILNPSSAPIDSEHIL
GVEGRLNSLLDVNGGISKRKDATNGYLKLLLVTAAEGDNAGGTSKSVRDLSLILDALLKT
RSNSVLLDIINKNGLQMLHNILKQNKSDFHRIPIIRKLVKVLEFLASKGILTSEHINGGP
RCAGTESFRESMLGLLRHNDMQVQQIARNFRDRWIQWAPRNISRNEPTEYSRASISAHDI
HVISTAGGSFPTSANTMDWKSIRRKRKSRWDYQPDDHYKMGGLKIQKVCPVQSEFRTGSV
GNKLHGNWGTNSSHNDVPVVGSSADGADDEAPPGFESQQESRPGQACLESGVSPGLYLER
YQHNLTISYGIPIAFVEHFGTPEVEGGPCRKNWKVAPGVPFQPFPPLPPYPRGSPCPSTQ
MSQHEHNSLGHCGRAANRDGRIHRNWRNGARTKFPYNHQGRRFPNNNQRF*

5'UTR

chr02:20896221..20896433 (+ strand) : 213 bp

chr02:20896530..20896668 (+ strand) : 139 bp

CDS

chr02:20896669..20900326 (+ strand) : 3658 bp

chr02:20900422..20900620 (+ strand) : 199 bp

chr02:20901541..20901680 (+ strand) : 140 bp

chr02:20901790..20901869 (+ strand) : 80 bp

chr02:20903160..20903291 (+ strand) : 132 bp

chr02:20903365..20903481 (+ strand) : 117 bp

chr02:20904115..20904207 (+ strand) : 93 bp

chr02:20904487..20904564 (+ strand) : 78 bp

chr02:20904768..20904824 (+ strand) : 57 bp

chr02:20905149..20905818 (+ strand) : 670 bp

chr02:20905901..20905956 (+ strand) : 56 bp

chr02:20906493..20906569 (+ strand) : 77 bp

chr02:20906641..20906723 (+ strand) : 83 bp

chr02:20906814..20906893 (+ strand) : 80 bp

chr02:20907666..20907745 (+ strand) : 80 bp

chr02:20908304..20908349 (+ strand) : 46 bp

chr02:20909315..20910121 (+ strand) : 807 bp

3'UTR

chr02:20910122..20910475 (+ strand) : 354 bp

FASTA

>Os02t0554000-02 class=Sequence position=chr02:20896221..20910475 (+ strand)
CCTCTTCCCC CCTTCTCTCT CTCTTCCTCC CTATCCGCCT CCTTCTCCGC CGCCTCCTCC CCGCAACGAC GCGGCGACTA
CGACGACCCG ACTCGCCGCC TCCTCGCCCC CCGCCGCCGC GGCGCGCGTA CGGACGGGCG GCGGGCCCCT CCTCGCCGGG
CGCCGGGGTC CGCAGGCATT CGCCGCCGCC GCCGTAGTGT GGCTTCGTTT GAGGTTGGTG TTCTCTCTCT CTCGTTGTTT
TTTATTTTTG GTCTCGGTAG GGTTTGGGCG GAATTCTGAT TGGGCGTTCG TTTGCGGTGG AGGTTGCAGG GGCTCGCGAA
TTCTAGGGTT TTTTTTTGGG TGTGATCGGA GGTGGGGAGA AGCGGCGAGG ACGCGGGGGG AGGGGAGGTG GGGGGGCGTG
CATTGGATGG TCTCGATCCG TGCGGCTCCC CGCTGACACG CTGCTTCGAT GGAGGAGCCT GACGGGGAAG CGCGTGGGCG
GGAGGATCAT GCTGCGGTTG GGCGGTTGGG AGGAGAGGAG GGTGCTGTTG GCGGCGGTGG CCTGGCTTTG CTCGCTGTTC
CTGAGATTGG CGGTGAGCTC GGTGATGGTG GGAAGGTCTG CGGTGGTCAG GAGAGGCGCC TGCCCACAGA GGAAGATGGA
GTCCGAGATA ATGGAGGTGG CTCCGCTGCA GAATTGGTGG AATCTGCTGT GAATGTTTCT ACCCCTTTTG AAGGAAGGGG
TCAGATTGGT GGTGAGAAGG AGTCTAGTAT GCAGGAGGGG TCTATGAACA TGGCGGGAGA GAAGCATGGC AGTTATCATG
TGGAATCTGC TGAACCCAGC AATTTGCAGA CGTGTCATGC GCCCAATGGC GGGGTATCGA ATAAGACATT ATTTGCTCCC
TTCAGCGAAG TTTTCTCCAG TGATAACAGC CATATGCGTT ACTTGCTGGA CAAAGCGACA GAGGGGAGCA TTTGTGAGCA
TGGTGATTTG GCGGACAGTA AAGATGATTT GGGTGGCGCA ACGGACGTAA AGACAAACAC AGAAGATTTA CAGATGGTTT
GCACGAAACC ACATTGTGAT AGCGAGGGTT TGTCGGATTT GCATAATGAC AGTGAGCGAT GGCCACAAGT GGTTGATGGG
GTGGGATTTA CGATAAAGGG TAATAATGAG CTGAAACAAG TTGATTTGAT ACCAAAAATT GAAGCTGAAG TCTCTAGGTC
GGTGGAGGAT GATTCAATCC CTTCTTTTTC TGGTGGTATT GATGATTCTT TACGCAAGGC AGGTTGTGCG TGTGAAACTC
TCAATGATAT GGGGATGTCT CATATGGCCA ATGGTGATTT GTGGTGCAAT GTTTTATATG CCCCTCTTAG TGAAGGATGC
CAGTCCAAGG ATGCTCGACA CATAGCAGTC ATGGGGAACA AGGTGACACA GGGGAGTCAA TGCGGGCAGG GTGATTTGGC
GTGTGATGGA ATTGTTTTGC GAGGTGGGGT AGATGTAGAG AAAAGTCTAG ATGATTTACA GATGTGTTCC AAGGAACCAC
AATGTGATAA CAAGGGCTTT CCATATTTGA CAGAATTTGG TGTCCAGCAG CCATCATATG GCATGAATGT CATATGTTCG
AAGACAGATC CTAACCATCA GCTGGAAAAG GATGAATTGT TGACAAATAC TAGAGGAGAG TTCTCTAGTT CTATCCATGA
GGATTCAGTT CCTTCAATTT CTGTGAGCTC TGTTGATTTT ACTTTTGATG GCAATGCTGG TCAGATTGGT AAAACATCTG
AGCATAGAGC AATCATGGAG AAAGTGTCGC ATGGTTCACA GCGAGGAGGT GTACTTTCCT GTGAGAGTAG GTCTTTAAAG
GAGTCTCATG CAGATGAGAA TCAGAGTTCC ACATTGGAGG TTAAGACATG TGAAGAGGGC TTACAGACAG GTCAAGTGGA
ACCATGCCAC AGCATCGTAG CTTTGTCGGA TTCAGGGAAG TATGGCACCG ACATATTACC ACGTGGTGGT GACGGTCTGA
GATCGATGAC TGGTGCTAAC CATGAGCTGG TAAAGGATGA TTTTCATCCA AAAAGTGATG TAGTGGTCTC CTGTCCAGTG
GATGAGGCAT CGATTCCCTC TAACTATAAT AGCCCCATTG ATGTTCTTTT ATACAAAGAG GATGGTTTAG TTGGTGAGAT
ATCTGAAAAT AGAATTGGTG TGGAGAAATT GGCTCATGAT TTGCTCGGAG AAGTTATGCT TTCATTTGAC AGCAGGCCTC
AGACTGAGGC TTCTGGAGAT GAGAATCAAC ACTTCTGGAT GGATGTTCCA AAGGGTTCAA CTGCATCTGT TTGTGAAGTA
GAAAATACAG GCACTAGAAG ATCTTGTGAT CCCTGTGCTG AAATAGAGTT TCCACTCCAA CAAAGTCGTG AAAAGCATGT
GATCTCTGAA TCCCCCCCAG AGAGAGATCT GACTAGTTCG TCCCATAACC TACCTTGTGA AAATGAACCT TGTTATAGTG
GCAGGGAAAC ACCCGCCTTC TGCCTAGGCC ATCAAGATTC TGCTGGTCTT GGACTGGAAT CTTCAGACTG TTTGGTACAA
GAGCTCAATA CGTGTACTTC CACTGATGAC AAAGCTTGCT CTGTTGATTT TGTTGAGAAT GGTAATGGTT CTCATAACCA
AAAGGAAGTG CCGGTGATTT TCTTCAGGCG GAGGAATCCA GTAAGAGCTG CCTCTTCAAG AAATTCTAAT TTTGAGAAGT
GTGACCAGAT AAACAAATCA GGTAATAGTA CACGCAAATC TAAGAAGGTT GACAGTGTAA GCTCATTACT TAAAAGCACC
ATGATTAAGT TCCCAAACAA AACCACAAAG GGAAGAAGTG GCATCAATAG GCCATTGAAC TCTTCTGCTT GGGGCAGCCT
ACAAAAGCTA ATGGATGGTT TCAATCAGAA CTGTGGTCCT TCAACTTCTC GTTCTCATCA AACTTGTTTG GGAAAAGAAA
TATCAAATAG AGGATCTAGC GAGAAAAAAC AGCTATCTAT TCGGAAAATT CGAACTTCAA GATGTTCAAA ATATAAAAAC
ACATCACTTT CTGATATTGG ATATTTAGCA GGTGAATTGA ATGGCCAACC GACCTGTTCA GTGAGGATTG ATACTAATGT
TTCTTCTGAT GCATTGTTCA ATTCTCCGAA TGGTGCTCAC AAAGCTGCAC AGTGTGTTGA AGGTAATCAT ACTCTAAAAT
TAACATCTAG CCTGACTGAC ACACAACAGT TTGGCTTGGA GAATGTTACT CAAGAAACAT GCCCTGGGTA CATCCATGGA
GAGTGTGGTA CTTCAACTTC TGAACGTTCT CTAAATAATA TAGTTGGGTT TTCACCAGAC TCTGTTTTGG ATATAGCTTC
TGTTACATGT GAAAGCAACA CTTCTGCAAC CCTTGATGTT ATAGTGCATG AAAACCCATC TTGTCCTGGT GGATTGATTG
GAGGTGGTCT TCGTGCATCT GCTTTATCTA CTTCTCACTG TGAAAATCAT CATGCTTCAT CATTGATGGA TTTGGAGCAG
CAGGTCAAAA CTGTGAGGGA GAACGACATG GGAGAGGAAG ATGTCATTCC ATCACATGCC ATGATGTACA ATGATATTGG
TGAAGGAAAG CAAACTTTAG CGAAGTCCAA TACGATGAGG AAAGGTAGAA ATGTGGGAAA GCAGGAATGC CGAAAGAAAG
ATGGAAAGAA GGGAAAAAAC ATAAACAAAA ATAGAAGTTC CACCAAAATT TCATCTAGTG AAGCTTCAAA ACTCGTGTCC
TTTTCTAATG ATTCACCTTC ACTTGATCCA TCTGAGTTGC TGCTTCATAC GAGACCTCCA AAGTTTGGTT CTTGTTCTAA
GGTCGTAACT TCTGCCATAC ATGATGTTGG TATGCATGGA TATGACAATA TGCGTCCTTT TGGAATTGAC AATGATGACG
AAGGGAGTGC ATTTGACAAT GTGAAATCAC TAAGGCGCAA GAAAAAGGAT AGTCATGGAG GAAAGAAGGG TAAGGTGCGG
GATCCACATG GGAAGGGCAG AAGCAAGAAG AAAAATATAG CTGATAACAC CTACGGTTTG CCGGCTCAGT TAACTGACCT
GTCAGAACCT CGCATGAATA AACAGAGTAT ATATTTTCAT CTTTGACTTC TATCATTTGA TCCTCCTTTA CTATCATTTA
TCAAGTAGCT TCTGTTGGTG CTAACTATCT TATTTATACA GGTGATCTTA TTCCTGCTGC TGAACTTGTA TTCAAGAACT
CTTCTGCCGT ATCTGTTGAA TTACCTGCAG TTGTTGCTTG CAAAACTGAT GGTGCATCTG TACCACCAGC ACCTgcttgg
gtttgttgtg atgattgcga aaaatggcgc tgcataccaa ctgaactggc agataaaatc tcaaaagaaa atctcagatg
gtattgattt ccatcctgcc atccctattt gatcaatttt cttggttgca ccagtcctct aacctaattg agtaatcata
cgctGAAATC TATTACTGCA TTGTTCCACT GGAAAATAAC TCATTTGAAA TCCTTTTTGT TTGGATTTCC TTTTGTTTTG
CTATGCTAGT CCACAATCAC CTATGTGAAA TAGAAAAGTT TGGTAAAATG GAAAACATAT TTCTTTCTAA AGGAAGAAAG
ACTTCTGACA CTATATTTAG ATAATCTGTA GAGTAAATCT TACATTTTGC ATTTGTTTGT GCTCTATCAT TTTGGCAGTT
GGCTAGCAGC CAGCCAGTTA CCCAGAGGAA GAAAGGTGCT TCTTGCATGT TAGATGTGCC CATGTTCAAT ATTTCATATT
AGTATTTCCT GTGCAAACAG AGGCTGTTCA ATTCTACAGT GTAACTACAG ATATCTATTG CATTCCATTC CTTAAAATAT
TCGTATTTCA TGGGCCTTTT TCATTTATGC TCATACTTTC CACGGGATTC ATGTAGACTA TTAATGTATA TATGTAGAAG
CATATCGTTT GACTTGAGAG GTGATGTCAT GGgatttgtc ttgcataata ctttcataac agacagtttc catgtactat
attgtaatga aaaacatggg caatattgca ttggagactg aaaagtgaaa aatgacctgt gtttgtgaag tttgagaggg
CAAAGATTAA CCTTATTACC AACATGTGGC TCCGCTACAT TGAAAATATA TATTTTAATT CTTCCATTTG GTTTAATATT
ATTGATCTTT TTGATGTAGA TGTCATTTCA GATGTGTTTG CCTACTCATT TTGAATTTTT TCTTTATCTG TTGAATGGTT
AATAAATTAC AACTCATTTT CCTTTCTTGT TTATACAAAG GACTTGTAAG GAAAACGAAG ATAAGACATT TGCCAATTGC
TCTATACCAC AAGAGAAGAC AGATGATGAG ATCAATGCAG AGCTTGGGCT TTCAGATGCT TCTGCTGATG AAGCTAATGG
CGATGGATCA AACTCGAAAG GTTTGAATTT TTGACTCTAT ACATTCTGGT CAGAAAATGC AAAATTTTCT TTTGTTGCTC
TCTATCATAT CTGATTTGTG ACAAACTTTT TCATATTGCT GTGTTGCAGC TTCTGGAGAA CCAAACTTTG CACTTCTCAG
GTCAAACTTG TTTCTACATC GTAACCGCAG GACACAATCC ATTGATGAGG TATGGGTTGA TCTACTCACT TTTTATTTCT
TAATTGACAT TCTTTTGTTT TCTGTTTGTT AAATTTACCT AGCATTATTT TTTTCCGACC ATATTGCTTT TTATGTGCAA
GGAGCAGTTA AGATTCATAT AGAGTTTTGT AGTTTATGTG TATTGTACTC AGAACATGGT ATTGCAATAA ATCTTATGGG
GGGTGAGCAT GCTACACATT GTTAGGCTCA GTTTGTGGTT GCTGTGCTGC GCGCACTTGT TTTTTAAGTT CCCGTGGAAA
TGAACTTATA ATTATTGTAG CTTATTCTAC AAATCGAATC ACAGTTAGAT AAAATATGTT ATCCATCTGT CATGTTTTCC
CAATTTTCAT ATTTTACATT ATAATATTAT CGTTTGCCAC ATGGATCAAA ATAAAGGCAG TTTGCTCAAC ACCAAAATTC
AAAAGCTCTA TCTGAAAACG AGATTATCAT AAGGCACCGC AATACCAAGA TCAAAATAAA GGCAGTTTGC TCAACACCAA
AATTCAAAAG TTCTTTCTGA AAACGAGATT ATCATAAGGC ACCGCAATAC CAAACAGAGC TTTAGTTTCT CCACTTACCT
CATAGTTTCA CTTCCCATGC CGCGTGTAGG ATAAGCTGGA AAAAACTGTT ACTGAAGTGC CTATGTAAAG GCAGACAGTT
GTATCATAGC CACTCCAAAT CAAGGATGGC CATGGTTCAC AAGTTTTCAG TTACAGCAAA AATTCACAGT CAGTTTCACT
TGCGCACATT TCCATTTCTC CCTTCTGCTA CAGCATGATT AGTGGAAGGT GGAAACTGTT GTTCAGGACA AGTAAAATGC
TCCCCATGGC CTCTCTCTCT CTCTCTCTCT CTCTCTCTCA TATTATTTAT GTTTCTGCTC CCTCAACCTC TTGAATTTAT
ATTATCTCCT TTTTATTTTC TATCAGTACT CCCTACAGCC CTgaaaatca ttttggacat atccagtctt caaaatacaa
ttttgaccac taatttctat tgtgatatat ttttaagtaa ttttcgagac aaatctacac acatgattat attttttcat
gcctccaatc taattattta aaaatttatc gatattcaat tttttgaaag ttTGACAACA TGTCCGAAAG AACATGTTTA
TGTGCCTGGA TGGAGTACAG GCTAAACTGT CTTGAACTGT TGTAGACAAC TTATTATTTC TTTGTTCTTG GTTCTTTTGG
GGGTTGAAAT TCCAGCAGAC AAACCTGATA TTTCTATTTT TTTTATTCAA TAATGCAAGA GCATGGTATG CAATTGTAAG
CCGCCTCACG ATGACCGAAT GGGTTGTAGA GATGGTTGCT TGAACAGGAT ACTCAACATT GAATGCACCA AACGTACATG
TCCATGTGGG GAGCACTGTT CCAATCAGCA GGTTAGATTC TTTCATATCC TTGTTCTTGT TTCCTTACTA TGCTGGGTTT
GAACTTATAA AGTTCTTGGA ACAGTTCCAA AGGCGCACCT ATGCAAAACT TGGTAAGTTC CATACTGGTA AAAAGGGCTA
TGGATTGCAA TTGAAGGAAG ATGTATCTGA AGGACGATTC CTCATTGAAT ATGTTGGAGA GGTAGTGCTT CATGCTGCCT
ATCGTCCCCC CTCCTCTGTT TATTCCGGGT TTGTGGTGGC GTTATATTTC TGTTAGTGCA ACTTGCCCAT GGGAGCAATG
TTTTATGTTG GCATGTCACT AAATAATACC TTGTATCTGT TGATTGCACT GAGCCATTTG TGCATGCATG CATGTGTTGC
CAACATGCTC TGTTTTCTTT TTTTTTTTTT GCAGGGAAAC ATGCTCTGTT TAAATGTTGA TTATGTTGGT TTCACATTCG
TTGTAATGAA TACCTTGTTC TGACATAGCC AGGATACTTA TCTCATTCTT TTCACATGGA TATTGGTAAA AAAGCAAAAA
GAATGAAGAG ATAATGATTC CATTAGTAGC ATCCTTCATT CCATGCATCT ATTTTATATA GATATATTTT TAAACAACTG
TAACTCTGAT ATTACTTCGT CGTGTTTCCG ACTTATGTAT TAAAAATATA CTAGTATATA CAAATTCCAT TTTTATCCAA
AACTGTACAA CCCTCTGGTA CAGAAATTCT GTGTATTTAT GCAATCTGCT CTCTAACTCA ATTTCTCTTC TACTATTATG
AATGACCTCA TGTCTAATGA GTTTGTTGAT TTGCTTACTT CATTGTTGTT TCAGGTCCTT GATATAACGG CTTATGAATC
CCGCCAAAGG TATTATGCCT CTAAAGGCCA GAAGCATTTC TATTTCATGG CACTTAATGG TGGTGAGGTA TGTCTTTATT
TATTCTTAAC CAGTCATATT GCATAGATGT ACTCCCTCAT TTCTAACTTC ACGTCTTTCT CAATCCCTGC CACTTCTTAG
ATATGCCTTC GATTAGAAAT TATCAGATTA GTTCATTTAT ATCATTTCCT ATAATATCAA TAGATGATAC AAACAACCCA
GTGTGGTATC TGTTTTTCTT ATGTCAACCT TCATGATGCT AACACTTAAA ATTAAATCAG TTAATAGTTA ATACCACTTT
TGGCATTTTG CTTTGAACTC TTCTAGGTGA TAGATGCTTG TACTAAAGGA AACTTGGGCC GGTTCATCAA TCATAGCTGC
AGTCCTAATT GCCGTACAGA GAAGGTAAAA CCGTTTTATT TGATCTTTAT ATTTGAATAG CTGACCAGAT CCCTTGCCTT
TGTTACTTAA AATATCCTGA TAATGTCCAA TACAAGTCAT ATGTTATATT TACAAATAAA TAAATAAATA ATGATTGGTG
CATAAAATTG TGTAATTAGT TATATTCTTA TTTTGAGTCC ATTAAATTAC TTTTTCCTTG TGAGCAGTGG ATGGTCAATG
GTGAAGTCTG CATTGGAATA TTTGCTATGA GGAACATCAA GAAGGTAAGG CTAGAAACTT GAAATCATCA ATGAACATGA
TGCAGGTCCT GAGAAACTGA GAGTTTGCTT TATACTAGCT AAATTTAAAT ACCAACTTAA AATGTTGTAT ATTTTTTTGG
GAAAAACATA TTAATTTGCA AAAAAAAGTC ATATAAAATA GCCTAGCCAC ATGCAAAAGA CCCCAATTCA AGTGGTTATC
TGATACACTG ACTACCACCA CCACCTTTCT TATTGTAGAG ATAATTTGTG CAAATGAAAC GTATCCTTCA GTATAACCTA
TATCTGTATT ATATGTGCTG CACTTAATGG ATATTTATTT CCTCACAGGG TGAAGAATTG ACGTTTGATT ACAACTATGT
TCGTGTATCT GGTGCTGCTC CTCAGAAATG CTTTTGCGGT ACTGCCAAAT GCCGGGGTTA CATCGGTGGT GACATATCAG
GTGCTGATAT GATTACTCAA GATGATGCTG AAGCAGGGAC TTTCGAACCT ATGGCTGTTC AGGAGGATGC TGAGGAAGTA
CTTGGTGCAA ATGGTTTGTC CTCTCATGGC ACACATCTAG ATATTGTCGA CCATGAAGCT TCCACTAAAA CAGAAGATTC
AAATGATTGC CCATCTGTGA ACCCACCAGA GTTAGAATCT GAGCAACAAA CTTCAGGAAC CTTATTTGAC ACAAGTGAGC
CAGAAAATTC CTTAGAAGCA TTGAGCCCAC AGGATGATGA AGATGTCGTC CGCACACCTG TCCATGTGTC CCGGACAGTT
GAGAGTACGT CGCGGCAGTT TCCAGAATAT GGTACTCGGT CATCAGAAAT TTTGCAAAGG GCTCCATGCA CACTGGATGG
ACCAAAGGTT CCAAGCACAA CAAATGGAAT TCCGCCTAGT TCCGATTTGG GGAGCCACTG GGTACCAGGT TTCCACGCTA
ATAAGAAAAC CAATGTAAAA CATCATTTGA TTCTGAATCC ATCATCAGCT CCTATTGACA GTGAGCACAT TTTGGGAGGT
AATACTGTTC TTCCAAGTGT ATCTCTCTTT CTGTCTAGGG TTACATATGA CTGTTAATGA TCGCTACCTG ACATGCACAG
TTGAAGGAAG ATTGAACAGC TTGCTTGATG TAAATGGAGG TATTAGCAAA CGAAAAGTAT GTATCCTCTT GTCCTTTGCA
TTATATATAT ACTTCAATTA TAGACTAGGA CTGAATATAT TTTACTGATT TTTTGGCATC AACTCTTAAT TAGGATATGT
TGTCATATGC TAAATGGCTA AAAATCAACC CAGTTTTTTT ATGAGGCATT CTCTTACGGA GTTTGCACCG CGTTGGGGAT
TAGGGAAACT TATATAGTGG TATTCCACAT TTCTTGAGCG CAAATGCTAA AAGACAGTGT ATGAAATATG GATTAGTATT
TCTCACATTT ATTAGTATCA ATCTCAAGAA CATAGTGTAT GAACGACTTT CGATTGATTG AACTTCTACC TTTATTAGAC
TTCTTTAGGT TTAAATTGTT TCTTGGTCAT CCTTTTTGGT ACACGGTGTG GTTTGAACTT GAAAGGCTAG GCAATATTTG
CATGTGTTCT GTGTTGCATC AATTGGGCGT CAAGCAGTCC AAATATCTCT CCATTCTACC TTTTCTGTCA TTGGATATTA
TTCTAACTAC TGATAATTTT TTTTTCCAAA AGGACGCAAC AAATGGATAC TTGAAGCTTC TCCTTGTGAC TGCAGCGGAA
GGTGACAATG CTGGGGGCAC GTCTAAAAGG TTTGATTACC TAATAACATC CAGCAAGTTA CATTTGCCCA GTCTAAATAT
GCTTCTGTTA TATCTTTCAG TGTAAGGGAT CTTTCGTTAA TTCTTGATGC ACTTCTGAAA ACAAGATCCA ATTCTGTCCT
GTTGGATATC ATCAATAAGA ATGGTACATT TTCTTGCATT CTGCAGCTTT TTACGTGAAA TACAATCATC TAGAATTACT
GACTAATAAA CTATTTGTAC TATTTTCTGA CAGGACTGCA AATGCTTCAC AATATATTAA AGCAGAATAA AAGCGATTTC
CATAGGATAC CTATAATAAG AAAGCTTGTG AAGGTTTGCA TTTCTTTTTT ATGTTATGTC TTATTACATT AGTTTCCAAT
TAATATATCA CATTAGAGCA AGTACATCCC TTAACAACTG ATCTAGGTGC TACAGTGGAC ATATCAACCC CCACAAGATC
CTTGTTATCT ACTCCCTCTG ATTCTTTTAT GACTTGTGCA CAAAAATCAA GAAAAAAAAA CTCAAAATGA CTATTGTCCT
TCATTTATGC TGCACTGGAA AAGATGATAA TGTATTTTGT GAGATGGTGG CATTTATTTG GCAAGGGCAA ACAAGAAAGA
AAAGATGTAA AAATGCATAG AAATTCCAAA GCAACTTACA TTTAGGAAAG AGTTGAGTAG GCTAAAACGT ATTGCATTTG
GAATTGTAGG GGTGTTTTTT TTCCCTAGAC CTTTGGTACC ATTAATTATT ATATGCCACC TATTTTTTGG TGCTAACGTT
ATAATATTTT GGAGATTTTA TCATTAAACA TTTGTGAAAT GTACGAGGGA GAGATTTAGC ATGAGCCACT TACCACGTTT
AGCATGGGCG AAGCATTTTT GCTGTAACAC CTAAACCCAT GGCCCATAGC ACAGGTGCTA ACTACATACC CGTCCTCTAG
TACCTTCTTA ACAGATAGGG ATGGACATGC TTTTAATTTG TAATGAGTGC AATGCCTGCA CCACTGTTCT TATTTTCTGT
ATAACAAAAA AGAGAATAAT ATTTCTATCA CAGAATTATA TCATTATGGG ACCCTATTTT TTCCTTATGA GTAATCTTTC
TTCAGGTACT TGAGTTTCTA GCTTCCAAGG GCATTCTGAC ATCTGAACAT ATAAATGGTG GTCCTCGATG TGCTGGGACA
GAAAGGTTTG ATTATTCAAA CTTGTTATTT ATTCATTTGG TATTTTTCAT TCTTAGGTTT CATTATAGTT TTCTGTATAT
TTGCTTTGTG TAGCAACATA TTTTTTATGC CAAAACATGG TCTTCCGAGG AAATAAATGC AATTCTTGCT TGTTATTTTT
GTATGTTTGA TATTTCAAGC TTTCAAATTT TCAAATTTTG CTAGTACATC TTCTGTATGG CCTTTTGTAA TCCATCAAGC
AACCACTTGT GAAATGTGTT TGTAGCATTG CAATTTATTA TATTACAAGT CCCATATTAA AGAATATTTC CTAATGCTGC
CCTGAGTGAA CAGTATATTT GGAGGTGACA ATTTTGAATT CAAGACACTT GTTTTATGTA TATCTAATTG CAGTTGCAGG
TTTACCATTA ATTGTATTAC TAAGCTTTAG CCGTGCAAAT AACATGCTAT GGACAGTATT TTAATGCTCT AAATATAGCT
TCTTTTGCTG TTGAAGTTTT CATTTTGAAG CATCAATTCT ACAATTTTTC CTTACCTTTT ATTCTCTGAA ATTCGCATTG
CAGCTTCAGG GAGTCGATGT TGGGCTTGTT AAGGCATAAT GATATGCAGG TAATAAATAT ACTAATCCCA ACGTGTATGA
TTTTTATCTT GTTTTTTAGG TATTTGTTTG TGCATTGACT CTTTGTTTAG ATAGTATACA ATTCAGGCCA TGAACATAGT
ATAGAAAGAT TGCAAGTTTG CAAATGCAAT CAGCAAATTA ATTATTTTGG GAGGGAAATG TCACTTTAAA AGAAAGCAAT
ACAACATAAT TGGTAATACT AGTGCATGTT TCTGAACTTG TCATGCATAT ACATGGTTTG ATATTGATTG TTTCTGTATT
GTAAATGCTT AGTTTATCCA TGGACATAGG ACAAGTCTTT TTGCTTAGAG CAAAAAATGG AACCAAAATC AAGTTTTCTT
TATTTTCGTT AATGGATAAC CAATCCAAAT TTCCAATATA GTTTGAAAAT TCATATAGTT TTTTTGTTTG TAAATAAGTT
AGCAAATGTA TTAGTGTGAG TACTTCGCTG TAAACGGATT ATGCATTAGC ATCATCATGT TTACTTATGA ACAGCTGTAT
TCTTTGAGCC TTCCCGGAAA CTGCTGGAAC TTAGTTAAAT ACTCCCTCCG TTTCAGGTTA TAAGACGTTT TGACTTTCGG
caaagtcaaa ctgtttcaaa ttgaactaag tttatagaca aatatagtaa tatttataat actaaattag tttcatcaaa
tcaataattg aatatatttt cataataaat ttgtcttgga ttggaaatgt tactactttt ttctacaaac ttggttaaat
ttaaagcagt ttgactttga ccaaaGTCAA AAAGTCTTAT AACCTGAAAC GGAGGGAGTA CAATTTATAT TCTCTCTTAG
CTGGCTTGAT ATCTGTTGGT CTTTAATATA GGTTTTGCAA TAAGAATATT GTTTGTTATT ACCTGCATTT ATAGGCTTAG
TGATTCTCTG ATGTGAGGAT ATGACCTGTT TGATTCATAT AATGATTTTA ACAGGTTCAA CAGATTGCTC GGAACTTTCG
TGATAGATGG ATCCAATGGG CCCCTCGAAA TATTTCAAGA AATGAGCCAA CAGAATATTC ACGTGCATCC ATATCTGCAC
ACGATATTCA TGTCATTTCA ACAGCTGGTG GATCTTTTCC AACTTCAGCC AACACTATGG ATTGGAAATC CATCAGAAGA
AAACGCAAGA GCCGTTGGGA TTACCAACCA GATGACCACT ATAAAATGGG TGGCCTGAAA ATTCAGAAAG TTTGTCCTGT
ACAAAGTGAG TTTCGGACTG GCTCGGTGGG AAATAAGTTG CATGGTAATT GGGGAACGAA CAGCTCCCAC AATGATGTTC
CTGTGGTGGG AAGTTCAGCC GATGGTGCAG ATGATGAAGC ACCTCCTGGA TTTGAGTCTC AGCAGGAAAG TCGGCCTGGA
CAAGCTTGTT TAGAATCGGG GGTTTCTCCA GGATTATACT TGGAGAGGTA TCAACATAAC TTGACTATTT CATACGGGAT
TCCAATCGCT TTTGTTGAGC ATTTTGGAAC CCCAGAAGTT GAAGGAGGGC CATGTCGCAA AAACTGGAAA GTCGCACCTG
GTGTGCCTTT CCAGCCCTTT CCACCATTGC CGCCCTATCC AAGAGGGAGT CCTTGTCCTT CCACTCAGAT GTCTCAGCAT
GAACACAACA GTTTGGGACA TTGTGGCAGG GCTGCAAATA GAGACGGGAG AATACATAGG AATTGGAGAA ATGGGGCGAG
AACAAAATTT CCATACAATC ATCAAGGACG GAGATTTCCT AACAATAATC AAAGATTTTG AAAGTTGCCT GCTGCCTCCA
ACGTCTCAGG AGCAGGGTGA TCCAGGACCT AGAGGCAGGG AGTGACCCAA GTCCTGGTTT TTGAACCTCA AATAGTGGTT
TATACATTGT AGTTCCTGTT TATCAGAGCC CCAGAGGTGT ATCAGAATTG CGTGCGCCCG TAATTCTATT TAATAGGAGC
AGATGTTACT GTCAGTTTAT TAGAGGTAGA AACATATTCT GCAAATAGGT CATTGCCTTT GCGGTTCTTT TACTAATTAA
TTTGCCCATT GGCTCCCTCT GCGCTATGTG TAATCCCGAT AGGAATAATT GATTTGATTC AAATCGTTTT ACAGGCAAAA
TGGCTAATTG GTTTC

Locus: Os02g0554000

Loading...

Locus: Os02g0554000

Loading...