Os02t0554000-02

Locus

Os02g0554000

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SDG725

CGSNL Gene Name

SET DOMAIN GROUP PROTEIN 725

Oryzabase Gene Symbol Synonym(s)

OsSDG725, OsSET8, ASHH2

Oryzabase Gene Name Synonym(s)

SET Domain Group Protein725, SET DOMAIN GROUP725, SET protein 8, "ABSENT, SMALL, OR HOMEOTIC DISCS 1 HOMOLOG 2"

Transcript Evidence

AK106534 (DDBJ, Best hit)

Protein Evidence

B9F0I7 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

002-108-B04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0554000-02)

Others

Oryzabase (11165)

Transcript

1628 bp

>Os02t0554000-02 Conserved hypothetical protein.
TGAATCCATCATCAGCTCCTATTGACAGTGAGCACATTTTGGGAGTTGAAGGAAGATTGA
ACAGCTTGCTTGATGTAAATGGAGGTATTAGCAAACGAAAAGACGCAACAAATGGATACT
TGAAGCTTCTCCTTGTGACTGCAGCGGAAGGTGACAATGCTGGGGGCACGTCTAAAAGTG
TAAGGGATCTTTCGTTAATTCTTGATGCACTTCTGAAAACAAGATCCAATTCTGTCCTGT
TGGATATCATCAATAAGAATGGACTGCAAATGCTTCACAATATATTAAAGCAGAATAAAA
GCGATTTCCATAGGATACCTATAATAAGAAAGCTTGTGAAGGTACTTGAGTTTCTAGCTT
CCAAGGGCATTCTGACATCTGAACATATAAATGGTGGTCCTCGATGTGCTGGGACAGAAA
GCTTCAGGGAGTCGATGTTGGGCTTGTTAAGGCATAATGATATGCAGGTTCAACAGATTG
CTCGGAACTTTCGTGATAGATGGATCCAATGGGCCCCTCGAAATATTTCAAGAAATGAGC
CAACAGAATATTCACGTGCATCCATATCTGCACACGATATTCATGTCATTTCAACAGCTG
GTGGATCTTTTCCAACTTCAGCCAACACTATGGATTGGAAATCCATCAGAAGAAAACGCA
AGAGCCGTTGGGATTACCAACCAGATGACCACTATAAAATGGGTGGCCTGAAAATTCAGA
AAGTTTGTCCTGTACAAAGTGAGTTTCGGACTGGCTCGGTGGGAAATAAGTTGCATGGTA
ATTGGGGAACGAACAGCTCCCACAATGATGTTCCTGTGGTGGGAAGTTCAGCCGATGGTG
CAGATGATGAAGCACCTCCTGGATTTGAGTCTCAGCAGGAAAGTCGGCCTGGACAAGCTT
GTTTAGAATCGGGGGTTTCTCCAGGATTATACTTGGAGAGGTATCAACATAACTTGACTA
TTTCATACGGGATTCCAATCGCTTTTGTTGAGCATTTTGGAACCCCAGAAGTTGAAGGAG
GGCCATGTCGCAAAAACTGGAAAGTCGCACCTGGTGTGCCTTTCCAGCCCTTTCCACCAT
TGCCGCCCTATCCAAGAGGGAGTCCTTGTCCTTCCACTCAGATGTCTCAGCATGAACACA
ACAGTTTGGGACATTGTGGCAGGGCTGCAAATAGAGACGGGAGAATACATAGGAATTGGA
GAAATGGGGCGAGAACAAAATTTCCATACAATCATCAAGGACGGAGATTTCCTAACAATA
ATCAAAGATTTTGAAAGTTGCCTGCTGCCTCCAACGTCTCAGGAGCAGGGTGATCCAGGA
CCTAGAGGCAGGGAGTGACCCAAGTCCTGGTTTTTGAACCTCAAATAGTGGTTTATACAT
TGTAGTTCCTGTTTATCAGAGCCCCAGAGGTGTATCAGAATTGCGTGCGCCCGTAATTCT
ATTTAATAGGAGCAGATGTTACTGTCAGTTTATTAGAGGTAGAAACATATTCTGCAAATA
GGTCATTGCCTTTGCGGTTCTTTTACTAATTAATTTGCCCATTGGCTCCCTCTGCGCTAT
GTGTAATCCCGATAGGAATAATTGATTTGATTCAAATCGTTTTACAGGCAAAATGGCTAA
TTGGTTTC

CDS

1272 bp

>Os02t0554000-02 Conserved hypothetical protein.
AATCCATCATCAGCTCCTATTGACAGTGAGCACATTTTGGGAGTTGAAGGAAGATTGAAC
AGCTTGCTTGATGTAAATGGAGGTATTAGCAAACGAAAAGACGCAACAAATGGATACTTG
AAGCTTCTCCTTGTGACTGCAGCGGAAGGTGACAATGCTGGGGGCACGTCTAAAAGTGTA
AGGGATCTTTCGTTAATTCTTGATGCACTTCTGAAAACAAGATCCAATTCTGTCCTGTTG
GATATCATCAATAAGAATGGACTGCAAATGCTTCACAATATATTAAAGCAGAATAAAAGC
GATTTCCATAGGATACCTATAATAAGAAAGCTTGTGAAGGTACTTGAGTTTCTAGCTTCC
AAGGGCATTCTGACATCTGAACATATAAATGGTGGTCCTCGATGTGCTGGGACAGAAAGC
TTCAGGGAGTCGATGTTGGGCTTGTTAAGGCATAATGATATGCAGGTTCAACAGATTGCT
CGGAACTTTCGTGATAGATGGATCCAATGGGCCCCTCGAAATATTTCAAGAAATGAGCCA
ACAGAATATTCACGTGCATCCATATCTGCACACGATATTCATGTCATTTCAACAGCTGGT
GGATCTTTTCCAACTTCAGCCAACACTATGGATTGGAAATCCATCAGAAGAAAACGCAAG
AGCCGTTGGGATTACCAACCAGATGACCACTATAAAATGGGTGGCCTGAAAATTCAGAAA
GTTTGTCCTGTACAAAGTGAGTTTCGGACTGGCTCGGTGGGAAATAAGTTGCATGGTAAT
TGGGGAACGAACAGCTCCCACAATGATGTTCCTGTGGTGGGAAGTTCAGCCGATGGTGCA
GATGATGAAGCACCTCCTGGATTTGAGTCTCAGCAGGAAAGTCGGCCTGGACAAGCTTGT
TTAGAATCGGGGGTTTCTCCAGGATTATACTTGGAGAGGTATCAACATAACTTGACTATT
TCATACGGGATTCCAATCGCTTTTGTTGAGCATTTTGGAACCCCAGAAGTTGAAGGAGGG
CCATGTCGCAAAAACTGGAAAGTCGCACCTGGTGTGCCTTTCCAGCCCTTTCCACCATTG
CCGCCCTATCCAAGAGGGAGTCCTTGTCCTTCCACTCAGATGTCTCAGCATGAACACAAC
AGTTTGGGACATTGTGGCAGGGCTGCAAATAGAGACGGGAGAATACATAGGAATTGGAGA
AATGGGGCGAGAACAAAATTTCCATACAATCATCAAGGACGGAGATTTCCTAACAATAAT
CAAAGATTTTGA

Protein

424 aa

>Os02t0554000-02 Conserved hypothetical protein.
NPSSAPIDSEHILGVEGRLNSLLDVNGGISKRKDATNGYLKLLLVTAAEGDNAGGTSKSV
RDLSLILDALLKTRSNSVLLDIINKNGLQMLHNILKQNKSDFHRIPIIRKLVKVLEFLAS
KGILTSEHINGGPRCAGTESFRESMLGLLRHNDMQVQQIARNFRDRWIQWAPRNISRNEP
TEYSRASISAHDIHVISTAGGSFPTSANTMDWKSIRRKRKSRWDYQPDDHYKMGGLKIQK
VCPVQSEFRTGSVGNKLHGNWGTNSSHNDVPVVGSSADGADDEAPPGFESQQESRPGQAC
LESGVSPGLYLERYQHNLTISYGIPIAFVEHFGTPEVEGGPCRKNWKVAPGVPFQPFPPL
PPYPRGSPCPSTQMSQHEHNSLGHCGRAANRDGRIHRNWRNGARTKFPYNHQGRRFPNNN
QRF*

5'UTR

chr02:20905774..20905775 (+ strand) : 2 bp

CDS

chr02:20905776..20905818 (+ strand) : 43 bp

chr02:20905901..20905956 (+ strand) : 56 bp

chr02:20906493..20906569 (+ strand) : 77 bp

chr02:20906641..20906723 (+ strand) : 83 bp

chr02:20906814..20906893 (+ strand) : 80 bp

chr02:20907666..20907745 (+ strand) : 80 bp

chr02:20908304..20908349 (+ strand) : 46 bp

chr02:20909315..20910121 (+ strand) : 807 bp

3'UTR

chr02:20910122..20910475 (+ strand) : 354 bp

FASTA

>Os02t0554000-02 class=Sequence position=chr02:20905774..20910475 (+ strand)
TGAATCCATC ATCAGCTCCT ATTGACAGTG AGCACATTTT GGGAGGTAAT ACTGTTCTTC CAAGTGTATC TCTCTTTCTG
TCTAGGGTTA CATATGACTG TTAATGATCG CTACCTGACA TGCACAGTTG AAGGAAGATT GAACAGCTTG CTTGATGTAA
ATGGAGGTAT TAGCAAACGA AAAGTATGTA TCCTCTTGTC CTTTGCATTA TATATATACT TCAATTATAG ACTAGGACTG
AATATATTTT ACTGATTTTT TGGCATCAAC TCTTAATTAG GATATGTTGT CATATGCTAA ATGGCTAAAA ATCAACCCAG
TTTTTTTATG AGGCATTCTC TTACGGAGTT TGCACCGCGT TGGGGATTAG GGAAACTTAT ATAGTGGTAT TCCACATTTC
TTGAGCGCAA ATGCTAAAAG ACAGTGTATG AAATATGGAT TAGTATTTCT CACATTTATT AGTATCAATC TCAAGAACAT
AGTGTATGAA CGACTTTCGA TTGATTGAAC TTCTACCTTT ATTAGACTTC TTTAGGTTTA AATTGTTTCT TGGTCATCCT
TTTTGGTACA CGGTGTGGTT TGAACTTGAA AGGCTAGGCA ATATTTGCAT GTGTTCTGTG TTGCATCAAT TGGGCGTCAA
GCAGTCCAAA TATCTCTCCA TTCTACCTTT TCTGTCATTG GATATTATTC TAACTACTGA TAATTTTTTT TTCCAAAAGG
ACGCAACAAA TGGATACTTG AAGCTTCTCC TTGTGACTGC AGCGGAAGGT GACAATGCTG GGGGCACGTC TAAAAGGTTT
GATTACCTAA TAACATCCAG CAAGTTACAT TTGCCCAGTC TAAATATGCT TCTGTTATAT CTTTCAGTGT AAGGGATCTT
TCGTTAATTC TTGATGCACT TCTGAAAACA AGATCCAATT CTGTCCTGTT GGATATCATC AATAAGAATG GTACATTTTC
TTGCATTCTG CAGCTTTTTA CGTGAAATAC AATCATCTAG AATTACTGAC TAATAAACTA TTTGTACTAT TTTCTGACAG
GACTGCAAAT GCTTCACAAT ATATTAAAGC AGAATAAAAG CGATTTCCAT AGGATACCTA TAATAAGAAA GCTTGTGAAG
GTTTGCATTT CTTTTTTATG TTATGTCTTA TTACATTAGT TTCCAATTAA TATATCACAT TAGAGCAAGT ACATCCCTTA
ACAACTGATC TAGGTGCTAC AGTGGACATA TCAACCCCCA CAAGATCCTT GTTATCTACT CCCTCTGATT CTTTTATGAC
TTGTGCACAA AAATCAAGAA AAAAAAACTC AAAATGACTA TTGTCCTTCA TTTATGCTGC ACTGGAAAAG ATGATAATGT
ATTTTGTGAG ATGGTGGCAT TTATTTGGCA AGGGCAAACA AGAAAGAAAA GATGTAAAAA TGCATAGAAA TTCCAAAGCA
ACTTACATTT AGGAAAGAGT TGAGTAGGCT AAAACGTATT GCATTTGGAA TTGTAGGGGT GTTTTTTTTC CCTAGACCTT
TGGTACCATT AATTATTATA TGCCACCTAT TTTTTGGTGC TAACGTTATA ATATTTTGGA GATTTTATCA TTAAACATTT
GTGAAATGTA CGAGGGAGAG ATTTAGCATG AGCCACTTAC CACGTTTAGC ATGGGCGAAG CATTTTTGCT GTAACACCTA
AACCCATGGC CCATAGCACA GGTGCTAACT ACATACCCGT CCTCTAGTAC CTTCTTAACA GATAGGGATG GACATGCTTT
TAATTTGTAA TGAGTGCAAT GCCTGCACCA CTGTTCTTAT TTTCTGTATA ACAAAAAAGA GAATAATATT TCTATCACAG
AATTATATCA TTATGGGACC CTATTTTTTC CTTATGAGTA ATCTTTCTTC AGGTACTTGA GTTTCTAGCT TCCAAGGGCA
TTCTGACATC TGAACATATA AATGGTGGTC CTCGATGTGC TGGGACAGAA AGGTTTGATT ATTCAAACTT GTTATTTATT
CATTTGGTAT TTTTCATTCT TAGGTTTCAT TATAGTTTTC TGTATATTTG CTTTGTGTAG CAACATATTT TTTATGCCAA
AACATGGTCT TCCGAGGAAA TAAATGCAAT TCTTGCTTGT TATTTTTGTA TGTTTGATAT TTCAAGCTTT CAAATTTTCA
AATTTTGCTA GTACATCTTC TGTATGGCCT TTTGTAATCC ATCAAGCAAC CACTTGTGAA ATGTGTTTGT AGCATTGCAA
TTTATTATAT TACAAGTCCC ATATTAAAGA ATATTTCCTA ATGCTGCCCT GAGTGAACAG TATATTTGGA GGTGACAATT
TTGAATTCAA GACACTTGTT TTATGTATAT CTAATTGCAG TTGCAGGTTT ACCATTAATT GTATTACTAA GCTTTAGCCG
TGCAAATAAC ATGCTATGGA CAGTATTTTA ATGCTCTAAA TATAGCTTCT TTTGCTGTTG AAGTTTTCAT TTTGAAGCAT
CAATTCTACA ATTTTTCCTT ACCTTTTATT CTCTGAAATT CGCATTGCAG CTTCAGGGAG TCGATGTTGG GCTTGTTAAG
GCATAATGAT ATGCAGGTAA TAAATATACT AATCCCAACG TGTATGATTT TTATCTTGTT TTTTAGGTAT TTGTTTGTGC
ATTGACTCTT TGTTTAGATA GTATACAATT CAGGCCATGA ACATAGTATA GAAAGATTGC AAGTTTGCAA ATGCAATCAG
CAAATTAATT ATTTTGGGAG GGAAATGTCA CTTTAAAAGA AAGCAATACA ACATAATTGG TAATACTAGT GCATGTTTCT
GAACTTGTCA TGCATATACA TGGTTTGATA TTGATTGTTT CTGTATTGTA AATGCTTAGT TTATCCATGG ACATAGGACA
AGTCTTTTTG CTTAGAGCAA AAAATGGAAC CAAAATCAAG TTTTCTTTAT TTTCGTTAAT GGATAACCAA TCCAAATTTC
CAATATAGTT TGAAAATTCA TATAGTTTTT TTGTTTGTAA ATAAGTTAGC AAATGTATTA GTGTGAGTAC TTCGCTGTAA
ACGGATTATG CATTAGCATC ATCATGTTTA CTTATGAACA GCTGTATTCT TTGAGCCTTC CCGGAAACTG CTGGAACTTA
GTTAAATACT CCCTCCGTTT CAGGTTATAA GACGTTTTGA CTTTCGGcaa agtcaaactg tttcaaattg aactaagttt
atagacaaat atagtaatat ttataatact aaattagttt catcaaatca ataattgaat atattttcat aataaatttg
tcttggattg gaaatgttac tacttttttc tacaaacttg gttaaattta aagcagtttg actttgacca aaGTCAAAAA
GTCTTATAAC CTGAAACGGA GGGAGTACAA TTTATATTCT CTCTTAGCTG GCTTGATATC TGTTGGTCTT TAATATAGGT
TTTGCAATAA GAATATTGTT TGTTATTACC TGCATTTATA GGCTTAGTGA TTCTCTGATG TGAGGATATG ACCTGTTTGA
TTCATATAAT GATTTTAACA GGTTCAACAG ATTGCTCGGA ACTTTCGTGA TAGATGGATC CAATGGGCCC CTCGAAATAT
TTCAAGAAAT GAGCCAACAG AATATTCACG TGCATCCATA TCTGCACACG ATATTCATGT CATTTCAACA GCTGGTGGAT
CTTTTCCAAC TTCAGCCAAC ACTATGGATT GGAAATCCAT CAGAAGAAAA CGCAAGAGCC GTTGGGATTA CCAACCAGAT
GACCACTATA AAATGGGTGG CCTGAAAATT CAGAAAGTTT GTCCTGTACA AAGTGAGTTT CGGACTGGCT CGGTGGGAAA
TAAGTTGCAT GGTAATTGGG GAACGAACAG CTCCCACAAT GATGTTCCTG TGGTGGGAAG TTCAGCCGAT GGTGCAGATG
ATGAAGCACC TCCTGGATTT GAGTCTCAGC AGGAAAGTCG GCCTGGACAA GCTTGTTTAG AATCGGGGGT TTCTCCAGGA
TTATACTTGG AGAGGTATCA ACATAACTTG ACTATTTCAT ACGGGATTCC AATCGCTTTT GTTGAGCATT TTGGAACCCC
AGAAGTTGAA GGAGGGCCAT GTCGCAAAAA CTGGAAAGTC GCACCTGGTG TGCCTTTCCA GCCCTTTCCA CCATTGCCGC
CCTATCCAAG AGGGAGTCCT TGTCCTTCCA CTCAGATGTC TCAGCATGAA CACAACAGTT TGGGACATTG TGGCAGGGCT
GCAAATAGAG ACGGGAGAAT ACATAGGAAT TGGAGAAATG GGGCGAGAAC AAAATTTCCA TACAATCATC AAGGACGGAG
ATTTCCTAAC AATAATCAAA GATTTTGAAA GTTGCCTGCT GCCTCCAACG TCTCAGGAGC AGGGTGATCC AGGACCTAGA
GGCAGGGAGT GACCCAAGTC CTGGTTTTTG AACCTCAAAT AGTGGTTTAT ACATTGTAGT TCCTGTTTAT CAGAGCCCCA
GAGGTGTATC AGAATTGCGT GCGCCCGTAA TTCTATTTAA TAGGAGCAGA TGTTACTGTC AGTTTATTAG AGGTAGAAAC
ATATTCTGCA AATAGGTCAT TGCCTTTGCG GTTCTTTTAC TAATTAATTT GCCCATTGGC TCCCTCTGCG CTATGTGTAA
TCCCGATAGG AATAATTGAT TTGATTCAAA TCGTTTTACA GGCAAAATGG CTAATTGGTT TC

Locus: Os02g0554000

Loading...

Locus: Os02g0554000

Loading...