Os02t0555700-01

Locus

Os02g0555700

Description

Similar to Chaperone protein dnaJ 10 (AtJ10) (AtDjC10).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC19

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C19

Transcript Evidence

AK108057 (DDBJ, Best hit)

Protein Evidence

NP_177828.2 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

002-138-A01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0555700-01)

RiceXPro (AK108057)

Others

Oryzabase (12176)

KEGG (Os02t0555700-01)

Transcript

1722 bp

>Os02t0555700-01 Similar to Chaperone protein dnaJ 10 (AtJ10) (AtDjC10).
CACCAGCATCGCCTCGCCGCCCAGCTGCTGCCGCTGCGCTTGCGCGTCCTCACTGGAAAG
ATGGCCCCCCTCTGCTCTGGCCCCTCTCCACTGCGGTATGAATGAATGATGCGCCTTTTC
TCCCTCCCCCCGCCCAGATCGATCGCCAGACCTGCACTTTCCAGTTCCCCATCCATGCTC
TGTCTGCTTCATCCTGTCCCAGCTTCTTCTTCTTCTTCTTCTTGTTGTTGTTGTTGTTCT
TGGTGCGGGAGGGTGTTCTTGGGGTAGGGAGCAGCATCGGCGGCGGCGGCGGTCATGGCG
AAGGAGACCGAGTTCTACGACGTGCTCGGCGTCTGCCCCGCCGCCTCCGACGACGAGATC
CGCAAGGCCTACTACATCAAGGCGAGGCAGGTGCATCCTGACAAGAACCCCAATGATCCG
CAAGCCGCCGAGAAATTCCAGGCTCTCGGAGAGGCCTACCAGGTGCTGAGTGATCCTCTT
CAGAGGAAGGCCTACGATGGCTATGGCAAGACCAGCATTTCCAAGGAGAACATGCTGGAT
GGCACTGTGGTGTTCACCCTTCTTTTCGGGAGTGAGCTGTTTGAGGACTACATTGGCCAC
CTTGCAATGGCAACAATGGCTTCCTCCGAGATGGCCAGCGACAATGACAACCCTGAAAAG
CTTCAGGACAGGCTCAAGGGTGTGCAAAGGGAAAGAGAAGAGAAGCTAGCAAGATTCCTC
AAGGAGTTCCTCTCGCAATACGTTCGTGGTGACCAGGAAGGATTCGCAAGCCGTGCCGAA
TCCGAGGCCAAGAGGCTGTCCAGCACTTCATCTGGACTAGACATTCTTCGCACAATTGGA
TATGTGTACTCCCGGCAAGCTGCAAAGGAGCTTGGCAAGAAGGCCATGTACCTTGGAGTC
CCATTCCTGGCAGAGTGGGTGAGGAACAAGGGTCACCTATGGAGGTCACAGATCACCGCG
GCGAAAGGAGCCTTGCAGTTGCTGCAGCTGCAAGAGGAGGCCTGCCGGCAGAGCGGTAAG
GACGGCTTGGCCACCGAGAGGGATGTCGATCTGCAGATGAGGATGAACAAAGACCTGATG
ATGAGCTCACTGTGGAAGCTGAATATTGTTGATATTGAAGTGACCCTTCTACACGTTTGT
GAAATGGTGTTGCATGAAAACAATGTCAAGAAAGAGGATCTCAAGGCTCGTGCAATGGCA
CTGAAAATTCTTGGGAAGATATTCCAGAGGGACAAGGAGGCATTGCCAGGACCATCAAAA
CCGACCATTCTCGATGATGACAGCAGCTCTGATGAAAGTTCAGATGACGACGTGGCTCGG
ACAGTGCCTTATCGGACTCCTGCAGTTACTCAGGGAATTGGCAGGTTATTCAGATGCTTA
TGCAACCCAGCATATGATGTTGACGATGACTTTGAACCACGCAAATGAGTGGTAAAGTAG
CAGAGAGGTTGCAACTATTTAAGAGATCCCTGAATCTTTCCAGATTATGTGCTTCTGAAC
AGTTGGGGATCATGCATCACCATAATTTGTCTGGGTGTGCATTGTAGATTCTACTGCAGC
ACTGGTGATCAGGCCATTAGCTCAAAATCGTTCTTTTTCTGTCCATGAACAGTAGATTCT
TTCTTGGTTTTTGATATAGATTTTATCGAATTGTGTGGTGTTTATGTAATTGTTTGGTTT
GGGAGTTGTCAAAAGAAAGAAAGCAAGAACAAGTGTAACTGG

CDS

1134 bp

>Os02t0555700-01 Similar to Chaperone protein dnaJ 10 (AtJ10) (AtDjC10).
ATGGCGAAGGAGACCGAGTTCTACGACGTGCTCGGCGTCTGCCCCGCCGCCTCCGACGAC
GAGATCCGCAAGGCCTACTACATCAAGGCGAGGCAGGTGCATCCTGACAAGAACCCCAAT
GATCCGCAAGCCGCCGAGAAATTCCAGGCTCTCGGAGAGGCCTACCAGGTGCTGAGTGAT
CCTCTTCAGAGGAAGGCCTACGATGGCTATGGCAAGACCAGCATTTCCAAGGAGAACATG
CTGGATGGCACTGTGGTGTTCACCCTTCTTTTCGGGAGTGAGCTGTTTGAGGACTACATT
GGCCACCTTGCAATGGCAACAATGGCTTCCTCCGAGATGGCCAGCGACAATGACAACCCT
GAAAAGCTTCAGGACAGGCTCAAGGGTGTGCAAAGGGAAAGAGAAGAGAAGCTAGCAAGA
TTCCTCAAGGAGTTCCTCTCGCAATACGTTCGTGGTGACCAGGAAGGATTCGCAAGCCGT
GCCGAATCCGAGGCCAAGAGGCTGTCCAGCACTTCATCTGGACTAGACATTCTTCGCACA
ATTGGATATGTGTACTCCCGGCAAGCTGCAAAGGAGCTTGGCAAGAAGGCCATGTACCTT
GGAGTCCCATTCCTGGCAGAGTGGGTGAGGAACAAGGGTCACCTATGGAGGTCACAGATC
ACCGCGGCGAAAGGAGCCTTGCAGTTGCTGCAGCTGCAAGAGGAGGCCTGCCGGCAGAGC
GGTAAGGACGGCTTGGCCACCGAGAGGGATGTCGATCTGCAGATGAGGATGAACAAAGAC
CTGATGATGAGCTCACTGTGGAAGCTGAATATTGTTGATATTGAAGTGACCCTTCTACAC
GTTTGTGAAATGGTGTTGCATGAAAACAATGTCAAGAAAGAGGATCTCAAGGCTCGTGCA
ATGGCACTGAAAATTCTTGGGAAGATATTCCAGAGGGACAAGGAGGCATTGCCAGGACCA
TCAAAACCGACCATTCTCGATGATGACAGCAGCTCTGATGAAAGTTCAGATGACGACGTG
GCTCGGACAGTGCCTTATCGGACTCCTGCAGTTACTCAGGGAATTGGCAGGTTATTCAGA
TGCTTATGCAACCCAGCATATGATGTTGACGATGACTTTGAACCACGCAAATGA

Protein

378 aa

>Os02t0555700-01 Similar to Chaperone protein dnaJ 10 (AtJ10) (AtDjC10).
MAKETEFYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSD
PLQRKAYDGYGKTSISKENMLDGTVVFTLLFGSELFEDYIGHLAMATMASSEMASDNDNP
EKLQDRLKGVQREREEKLARFLKEFLSQYVRGDQEGFASRAESEAKRLSSTSSGLDILRT
IGYVYSRQAAKELGKKAMYLGVPFLAEWVRNKGHLWRSQITAAKGALQLLQLQEEACRQS
GKDGLATERDVDLQMRMNKDLMMSSLWKLNIVDIEVTLLHVCEMVLHENNVKKEDLKARA
MALKILGKIFQRDKEALPGPSKPTILDDDSSSDESSDDDVARTVPYRTPAVTQGIGRLFR
CLCNPAYDVDDDFEPRK*

5'UTR

chr02:20996824..20997117 (- strand) : 294 bp

CDS

chr02:20996737..20996823 (- strand) : 87 bp

chr02:20996587..20996646 (- strand) : 60 bp

chr02:20996391..20996473 (- strand) : 83 bp

chr02:20996126..20996279 (- strand) : 154 bp

chr02:20995854..20995983 (- strand) : 130 bp

chr02:20995605..20995763 (- strand) : 159 bp

chr02:20995345..20995523 (- strand) : 179 bp

chr02:20995098..20995178 (- strand) : 81 bp

chr02:20994866..20994992 (- strand) : 127 bp

chr02:20994699..20994772 (- strand) : 74 bp

3'UTR

chr02:20994405..20994698 (- strand) : 294 bp

FASTA

>Os02t0555700-01 class=Sequence position=chr02:20994405..20997117 (- strand)
CACCAGCATC GCCTCGCCGC CCAGCTGCTG CCGCTGCGCT TGCGCGTCCT CACTGGAAAG ATGGCCCCCC TCTGCTCTGG
CCCCTCTCCA CTGCGGTATG AATGAATGAT GCGCCTTTTC TCCCTCCCCC CGCCCAGATC GATCGCCAGA CCTGCACTTT
CCAGTTCCCC ATCCATGCTC TGTCTGCTTC ATCCTGTCCC AGCTTCTTCT TCTTCTTCTT CTTGTTGTTG TTGTTGTTCT
TGGTGCGGGA GGGTGTTCTT GGGGTAGGGA GCAGCATCGG CGGCGGCGGC GGTCATGGCG AAGGAGACCG AGTTCTACGA
CGTGCTCGGC GTCTGCCCCG CCGCCTCCGA CGACGAGATC CGCAAGGCCT ACTACATCAA GGTCTTGCTT CTTGCTTGTT
ATGCCAACTC TGCTCGGAGA GTCGGTGCTG ATTTGTTTTT TTTTTTCGGT TTTTGGTTTC TTGATGTCCA GGCGAGGCAG
GTGCATCCTG ACAAGAACCC CAATGATCCG CAAGCCGCCG AGAAATTCCA GGTTGTTTCC TGCTACTCAG CTCAAGTTGG
TTTCTTGCTT GGATGGTTTT TTTTTAATTA AATTCAGTTT GCTTTGTCTG ACCAGCTGAG CTTTCTTGGG TGGATTTTTT
GCAGGCTCTC GGAGAGGCCT ACCAGGTGCT GAGTGATCCT CTTCAGAGGA AGGCCTACGA TGGCTATGGC AAGACCAGCA
TTTCCAAGTA GCCAAACAAA CCCATCTGAG ATGATTGATT GACTCTCTGC AGTCTGTGGC AATTCAAGTT TCAGGTTAAC
AAATGTTTTG TTTTGTTTTG TTTTGTTTGT TTTTTCAGGG AGAACATGCT GGATGGCACT GTGGTGTTCA CCCTTCTTTT
CGGGAGTGAG CTGTTTGAGG ACTACATTGG CCACCTTGCA ATGGCAACAA TGGCTTCCTC CGAGATGGCC AGCGACAATG
ACAACCCTGA AAAGCTTCAG GACAGGCTCA AGGTCAGTGA GCTCAATAGC CATTGCAGCC ATCTGTGATT ATGGATGCTC
CAAAGCCAGT TTGATTTTTC TCTCCTTTCT GATGGAATGT TGGCACTAGA CTAGTTGATA CTAACCATTC TGTTCTATGT
TTATTGTGAC AAAGGGTGTG CAAAGGGAAA GAGAAGAGAA GCTAGCAAGA TTCCTCAAGG AGTTCCTCTC GCAATACGTT
CGTGGTGACC AGGAAGGATT CGCAAGCCGT GCCGAATCCG AGGCCAAGAG GCTGTCCAGC ACTTGTCAGT CTGATCGATC
CCCGCAATTC ATTTCGATCT CTATGCCAAT CTAAGAAAAG CTTCTTTTAA CTGTTCTGAA ATGCCATTGC TCAGCATCTG
GACTAGACAT TCTTCGCACA ATTGGATATG TGTACTCCCG GCAAGCTGCA AAGGAGCTTG GCAAGAAGGC CATGTACCTT
GGAGTCCCAT TCCTGGCAGA GTGGGTGAGG AACAAGGGTC ACCTATGGAG GTCACAGATC ACCGCGGCGA AAGGTGAAAA
TCTCGCAAAC CGGGGCTTTT GGTGTGTATT CATTAAAATT GCTGACTGAT TAGAGGACAA AAAGAACAAT GCAGGAGCCT
TGCAGTTGCT GCAGCTGCAA GAGGAGGCCT GCCGGCAGAG CGGTAAGGAC GGCTTGGCCA CCGAGAGGGA TGTCGATCTG
CAGATGAGGA TGAACAAAGA CCTGATGATG AGCTCACTGT GGAAGCTGAA TATTGTTGAT ATTGAAGTGA CCCTTCTACA
CGTTTGTGAA ATGGTATGCC TCAAGATATC ATAGAAATTT GCAGTGATAT GATTAATAGT TAGTTGGTAG TATCTGAACT
GCGATCGCCA AGTAGCACGA CATGCCTGTC TTATCTTCCA GGTTAACATG TCAAAATGAT TAGTACATTA AATTGAATTG
ATTCTCTTGT ACTTGTTAGG TGTTGCATGA AAACAATGTC AAGAAAGAGG ATCTCAAGGC TCGTGCAATG GCACTGAAAA
TTCTTGGGAA GATATTCCAG GTATATGTTA CTTGGCCTTT TCATTAGGAT AATTCATACC GCTACATGAG ATTTATTTTA
TCATAATTTG CAAATACCAT ATTAATTCAA TTGGACTACA AACAGAGGGA CAAGGAGGCA TTGCCAGGAC CATCAAAACC
GACCATTCTC GATGATGACA GCAGCTCTGA TGAAAGTTCA GATGACGACG TGGCTCGGAC AGTGCCTTAT CGGACTCCTG
CAGTTACTCA GGCAATTACT AAACTAAGCA GCTTTTATGT TGCATAGCAA AGCATTGCAT AATCAAGTGC CTGCTAATAT
TAGTTCCCAT GTTTTGTGGT TCAGGGAATT GGCAGGTTAT TCAGATGCTT ATGCAACCCA GCATATGATG TTGACGATGA
CTTTGAACCA CGCAAATGAG TGGTAAAGTA GCAGAGAGGT TGCAACTATT TAAGAGATCC CTGAATCTTT CCAGATTATG
TGCTTCTGAA CAGTTGGGGA TCATGCATCA CCATAATTTG TCTGGGTGTG CATTGTAGAT TCTACTGCAG CACTGGTGAT
CAGGCCATTA GCTCAAAATC GTTCTTTTTC TGTCCATGAA CAGTAGATTC TTTCTTGGTT TTTGATATAG ATTTTATCGA
ATTGTGTGGT GTTTATGTAA TTGTTTGGTT TGGGAGTTGT CAAAAGAAAG AAAGCAAGAA CAAGTGTAAC TGG

Locus: Os02g0555700

Loading...

Locus: Os02g0555700

Loading...