Os02t0557800-01

Locus

Os02g0557800

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR2, rr2, Osrr2, OsRR2, Rra10, OsRRA10

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 2, A-TYPE response regulator 2, Type A response regulator 2, A-type RR 10

CGSNL Gene Symbol

RR2

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 2

Oryzabase Gene Symbol Synonym(s)

rr2, Osrr2, OsRR2, Rra10, OsRRA10

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 2, Type A response regulator 2, A-type RR 10

Transcript Evidence

AK070645 (Genbank)

AB249662 (Genbank)

BR000312 (Genbank)

Protein Evidence

Q6YVX7 (UniProt)

Literature

PMID: 16919402

PMID: 16472405

PMID: 17293362

Note

Manual Curation

April 9, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Full-length cDNA

J023061L14 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0557800-01)

RiceXPro (AK070645)

Others

Oryzabase (8159)

KEGG (Os02t0557800-01)

Transcript

1663 bp

>Os02t0557800-01 A-type response regulator, Cytokinin signaling
TCTTCTTCTTCTCTCGTCGTCGCGTCGCGCGCGGGCGGCGAGGCGAGGGCGTCGCGATTC
CTCCTCTTTCAAATACTCCCACGGCGAGGACCGCGGCGAGGGCGCGCGGGCCATTGCTGC
TGCTTCTTCTGCTGCTGCGTGTGTGTGGGTGAGACCTGAGAGGATGGGAGCGGAGGCGGT
GAGGGTGCTGGTGGTGGACGACTCGCCGGTGGACAGGCGGGTCGTGGAGCTGCTTCTCCG
GGCGCACTGCGGCGGCGGCGGCGGCGCCGCCGCCGGCGAGGCGGCTCCGTTCCACGTCAC
CGCCGTGGACAGCGGCAAGAAGGCGATGGAGCTGCTCGGCCGGCGGCGGGGGGACCGGGA
CCACCTCACCCCATCCTCTCCGGCGGCGGCGGCGGCGGCCAACGATCAAGCGATCGACAT
CGTGCTGACCGACTACTGCATGCCGGAGATGACAGGATACGATCTTCTCAAAGCCATCAA
GGCGTTGGGGTCGCCGAATCCGATCCCGGTGGTGGTCATGTCGTCGGAGAATGAGCCCCA
GAGGATCAGCAGATGCTTGACAGCCGGTGCCGAGGATTTCATCCTTAAGCCTCTCAAGAT
GAACGATGTCCAGCGCCTCCGGAAATGCTCCGGCGCCACCAGGCCGAAGTCCGCCGTCGC
CGGAGACGATGACCGGTGCTGCAACACGGCCAAGAAGGCGGCGGCGGCGGCCGCAGCCAC
ACCGGAGCAGCAGCAGCAGCAGCAGAGATCGTCGCACCTGGCAGGACTAGCCATGGTGAT
GAATGCATCCAGCTTCGAGGTGTCGCACTACTTCCAGCTCATCTTCAAGCTCATCCTGCT
CGCCTACGCCGTGCTGTGCCTCAGCCAGCTCCTGCACAGATGGTCCAATGGCAGCAGCCT
CCTCTCCCTGTGGTGCGCATGAATTCAAGAAATTAAATCAAATCGACGATCCAGAAGGCT
GGATTGATTAATTTCCCATTATCGATGAAAAAAATTGAAAAAAAAAGAGAGATGGATGAA
GACTCAGTGGCATAGCGTGGATTTATCCGAAACTGAAACCTCTTCATCAAGCAAGAGTGC
AGCTAAGGTGGACTAATTGGATGCATGATGATCTCCATCCCAGCTAAGCATGGGGGTTCT
TAATTAATTCAGCTATAATATAATTTTCAACAGCCATGCATGCAGCAGCAGCTAAGATGT
GATCTTTCTAGGGGTAGATTTGTTACTTATTTGTTCTTAAATTCTCAAGAGGATTCTAAC
CAGGTTATTAATTATTTTCAGAGGTTTTTAAGTGGTACTATACTACTACTGCTACTTAGA
TTATTTTGCTGAGAGAGAAAAGAGTAGCAGTACAGTAGCACCACAATTTGCTCATTTGTA
TAAAGGGGAACGCATGATTTGAGTGGGCATCTGGTGTCGTTTTTAATCCTGATCTCGATT
TGATACGCTGATGCAACTGTCCGGAGAAGCTTCTGCTTCTCTCTCTCTCCCAAGATGTGT
TTTTTTTTTCTTCTTTTTTTTCGCTCTCTTTCTCTCTGGGTGGGTGGACGTAGACGTCCA
CCTGCTCTGCACCTCACGCTGAATGAGTTGACCGGATCTCCCGTATTATATATCGTAATC
TTGTTAAATGTTAAGGGAGAAAGGAGAACAGTGTATGGTGATC

CDS

759 bp

>Os02t0557800-01 A-type response regulator, Cytokinin signaling
ATGGGAGCGGAGGCGGTGAGGGTGCTGGTGGTGGACGACTCGCCGGTGGACAGGCGGGTC
GTGGAGCTGCTTCTCCGGGCGCACTGCGGCGGCGGCGGCGGCGCCGCCGCCGGCGAGGCG
GCTCCGTTCCACGTCACCGCCGTGGACAGCGGCAAGAAGGCGATGGAGCTGCTCGGCCGG
CGGCGGGGGGACCGGGACCACCTCACCCCATCCTCTCCGGCGGCGGCGGCGGCGGCCAAC
GATCAAGCGATCGACATCGTGCTGACCGACTACTGCATGCCGGAGATGACAGGATACGAT
CTTCTCAAAGCCATCAAGGCGTTGGGGTCGCCGAATCCGATCCCGGTGGTGGTCATGTCG
TCGGAGAATGAGCCCCAGAGGATCAGCAGATGCTTGACAGCCGGTGCCGAGGATTTCATC
CTTAAGCCTCTCAAGATGAACGATGTCCAGCGCCTCCGGAAATGCTCCGGCGCCACCAGG
CCGAAGTCCGCCGTCGCCGGAGACGATGACCGGTGCTGCAACACGGCCAAGAAGGCGGCG
GCGGCGGCCGCAGCCACACCGGAGCAGCAGCAGCAGCAGCAGAGATCGTCGCACCTGGCA
GGACTAGCCATGGTGATGAATGCATCCAGCTTCGAGGTGTCGCACTACTTCCAGCTCATC
TTCAAGCTCATCCTGCTCGCCTACGCCGTGCTGTGCCTCAGCCAGCTCCTGCACAGATGG
TCCAATGGCAGCAGCCTCCTCTCCCTGTGGTGCGCATGA

Protein

252 aa

>Os02t0557800-01 A-type response regulator, Cytokinin signaling
MGAEAVRVLVVDDSPVDRRVVELLLRAHCGGGGGAAAGEAAPFHVTAVDSGKKAMELLGR
RRGDRDHLTPSSPAAAAAANDQAIDIVLTDYCMPEMTGYDLLKAIKALGSPNPIPVVVMS
SENEPQRISRCLTAGAEDFILKPLKMNDVQRLRKCSGATRPKSAVAGDDDRCCNTAKKAA
AAAAATPEQQQQQQRSSHLAGLAMVMNASSFEVSHYFQLIFKLILLAYAVLCLSQLLHRW
SNGSSLLSLWCA*

5'UTR

chr02:21131206..21131368 (- strand) : 163 bp

CDS

chr02:21131073..21131205 (- strand) : 133 bp

chr02:21130875..21130981 (- strand) : 107 bp

chr02:21130418..21130495 (- strand) : 78 bp

chr02:21130239..21130309 (- strand) : 71 bp

chr02:21129778..21130001 (- strand) : 224 bp

chr02:21129391..21129536 (- strand) : 146 bp

3'UTR

chr02:21128650..21129390 (- strand) : 741 bp

FASTA

>Os02t0557800-01 class=Sequence position=chr02:21128650..21131368 (- strand)
TCTTCTTCTT CTCTCGTCGT CGCGTCGCGC GCGGGCGGCG AGGCGAGGGC GTCGCGATTC CTCCTCTTTC AAATACTCCC
ACGGCGAGGA CCGCGGCGAG GGCGCGCGGG CCATTGCTGC TGCTTCTTCT GCTGCTGCGT GTGTGTGGGT GAGACCTGAG
AGGATGGGAG CGGAGGCGGT GAGGGTGCTG GTGGTGGACG ACTCGCCGGT GGACAGGCGG GTCGTGGAGC TGCTTCTCCG
GGCGCACTGC GGCGGCGGCG GCGGCGCCGC CGCCGGCGAG GCGGCTCCGT TCCACGGTGA GCGCTACCGT CTCTTTTGGT
TCTTTGCTCC TTTGCTCGCC TCGCCGCCGA CGCATGATCG TTTGCTGGCT TTTCCTCGAT CCTCCAGTCA CCGCCGTGGA
CAGCGGCAAG AAGGCGATGG AGCTGCTCGG CCGGCGGCGG GGGGACCGGG ACCACCTCAC CCCATCCTCT CCGGCGGCGG
CGGCGGCGGC CAACGTACGT CACCCATCAC CATACACTGC ATTGCAGATG AGCCATTTGA TTTTTCATCA CCTGATATAG
GAGTGTTCAT CAATTCTGAA CGAACTCGGT CTCTCTCACC CCCTCCTCTG ACACAAAGTC TAACTCGCTC TGTTCTTTCT
CTGTTCCTCG GAGAGAAATT TAATCCCTTC ACTAATCATC ACTAGCAGAG CAACAGTGCG GTAGTTTGAA TGTCTGATGA
GTTCTTTGAT GAAACTCATG TTGCCGTACA GTGCAAAATG CCTACGTAGT GCCACATCAA ATTGGAGATG AATCTTTTGT
CATTTCTTTT TTACCCTTTT CGATTTAGTC TGAAACTAGA GAGATGAAAA TGAGAATGGA CAAATCTTTG CAGGATCAAG
CGATCGACAT CGTGCTGACC GACTACTGCA TGCCGGAGAT GACAGGATAC GATCTTCTCA AAGCCATCAA GGTTGAGCGA
TGAAGAGCAT GTGAAACTTC TTCAAAGATT CTCTTTTCTG TTTCTGTTTT TGTCAGTTCA AATGTAAATT TGAGCATCTG
AATTTCTGAA TCTACTCAGG CGTTGGGGTC GCCGAATCCG ATCCCGGTGG TGGTCATGTC GTCGGAGAAT GAGCCCCAGA
GGATCAGCAG GTGAAGTTCT TGGCACCCAT TCTTTCTCCT CTTCTTTGCA AAACCATCAT CAATCAACTC GTTTGCAAAG
CTGAAGATAC TGTTTTTGTT TTTGTATATT GATGAAAGTT GCTTTTGCAA CTGTGGCTTC TCTCCGAAAG CCAAGATTTG
CACAGCTTTT CAGATTCAAA AGTCGGATTT GTGTGTGTGT GCATCACCAC TAACGCTAAC ATGTATGTCC TCTTTTGGTT
AAAGCAGATG CTTGACAGCC GGTGCCGAGG ATTTCATCCT TAAGCCTCTC AAGATGAACG ATGTCCAGCG CCTCCGGAAA
TGCTCCGGCG CCACCAGGCC GAAGTCCGCC GTCGCCGGAG ACGATGACCG GTGCTGCAAC ACGGCCAAGA AGGCGGCGGC
GGCGGCCGCA GCCACACCGG AGCAGCAGCA GCAGCAGCAG AGATCGTCGC ACCTGGCAGG ACTAGCCATG GCATGATCCC
TTTTCTTCTC AAATGCATAT CAAATTAACC TTTTGATCAA ACATGTCATA CGACGATATA CCTCATACta cctcatacta
cctagatacc aagaggtacc aaatttataa tagaaaaagt ggtacatcat gatacctcct caagtaacgt aaaattgctc
taaTTATATA TGCTGCGGTG ATCATTGGTT AATTTGTGGA TTTTTGTTTT CTTGTTTTTT GGTTTTTGCA GGTGATGAAT
GCATCCAGCT TCGAGGTGTC GCACTACTTC CAGCTCATCT TCAAGCTCAT CCTGCTCGCC TACGCCGTGC TGTGCCTCAG
CCAGCTCCTG CACAGATGGT CCAATGGCAG CAGCCTCCTC TCCCTGTGGT GCGCATGAAT TCAAGAAATT AAATCAAATC
GACGATCCAG AAGGCTGGAT TGATTAATTT CCCATTATCG ATGAAAAAAA TTGAAAAAAA AAGAGAGATG GATGAAGACT
CAGTGGCATA GCGTGGATTT ATCCGAAACT GAAACCTCTT CATCAAGCAA GAGTGCAGCT AAGGTGGACT AATTGGATGC
ATGATGATCT CCATCCCAGC TAAGCATGGG GGTTCTTAAT TAATTCAGCT ATAATATAAT TTTCAACAGC CATGCATGCA
GCAGCAGCTA AGATGTGATC TTTCTAGGGG TAGATTTGTT ACTTATTTGT TCTTAAATTC TCAAGAGGAT TCTAACCAGG
TTATTAATTA TTTTCAGAGG TTTTTAAGTG GTACTATACT ACTACTGCTA CTTAGATTAT TTTGCTGAGA GAGAAAAGAG
TAGCAGTACA GTAGCACCAC AATTTGCTCA TTTGTATAAA GGGGAACGCA TGATTTGAGT GGGCATCTGG TGTCGTTTTT
AATCCTGATC TCGATTTGAT ACGCTGATGC AACTGTCCGG AGAAGCTTCT GCTTCTCTCT CTCTCCCAAG ATGTGTTTTT
TTTTTCTTCT TTTTTTTCGC TCTCTTTCTC TCTGGGTGGG TGGACGTAGA CGTCCACCTG CTCTGCACCT CACGCTGAAT
GAGTTGACCG GATCTCCCGT ATTATATATC GTAATCTTGT TAAATGTTAA GGGAGAAAGG AGAACAGTGT ATGGTGATC

Locus: Os02g0557800

Loading...

Locus: Os02g0557800

Loading...