Os02t0557800-02

Locus

Os02g0557800

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

OSRR2, OsRR2, Osrr2, rr2

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 2, A-type response regulator 2, A-TYPE response regulator 2, Type A response regulator 2

CGSNL Gene Symbol

RR2

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 2

Oryzabase Gene Symbol Synonym(s)

rr2, Osrr2, OsRR2, Rra10, OsRRA10

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 2, Type A response regulator 2, A-type RR 10

Transcript Evidence

AK069453 (Genbank)

AB249662 (Genbank)

BR000312 (Genbank)

Protein Evidence

Q6YVX7 (UniProt)

Literature

PMID: 16919402

PMID: 16472405

PMID: 17293362

Note

Manual Curation

April 9, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Full-length cDNA

J023020J18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0557800-02)

RiceXPro (AK069453)

Others

Oryzabase (8159)

KEGG (Os02t0557800-02)

Transcript

1409 bp

>Os02t0557800-02 A-type response regulator, Cytokinin signaling
GCGCGGGCGGCGAGGCGAGGGCGTCGCGATTCCTCCTCTTTCAAATACTCCCACGGCGAG
GACCGCGGCGAGGGCGCGCGGGCCATTGCTGCTGCTTCTTCTGCTGCTGCGTGTGTGTGG
GTGAGACCTGAGAGGATGGGAGCGGAGGCGGTGAGGGTGCTGGTGGTGGACGACTCGCCG
GTGGACAGGCGGGTCGTGGAGCTGCTTCTCCGGGCGCACTGCGGCGGCGGCGGCGGCGCC
GCCGCCGGCGAGGCGGCTCCGTTCCACGTCACCGCCGTGGACAGCGGCAAGAAGGCGATG
GAGCTGCTCGGCCGGCGGCGGGGGGACCGGGACCACCTCACCCCATCCTCTCCGGCGGCG
GCGGCGGCGGCCAACGATCAAGCGATCGACATCGTGCTGACCGACTACTGCATGCCGGAG
ATGACAGGATACGATCTTCTCAAAGCCATCAAGGCGTTGGGGTCGCCGAATCCGATCCCG
GTGGTGGTCATGTCGTCGGAGAATGAGCCCCAGAGGATCAGCAGATGCTTGACAGCCGGT
GCCGAGGATTTCATCCTTAAGCCTCTCAAGATGAACGATGTCCAGCGCCTCCGGAAATGC
TCCGGCGCCACCAGGCCGAAGTCCGCCGTCGCCGGAGACGATGACCGGTGCTGCAACACG
GCCAAGAAGGCGGCGGCGGCGGCCGCAGCCACACCGGAGCAGCAGCAGCAGCAGCAGAGA
TCGTCGCACCTGGCAGGACTAGCCATGGTGATGAATGCATCCAGCTTCGAGGTGTCGCAC
TACTTCCAGCTCATCTTCAAGCTCATCCTGCTCGCCTACGCCGTGCTGTGCCTCAGCCAG
CTCCTGCACAGATGGTCCAATGGCAGCAGCCTCCTCTCCCTGTGGTGCGCATGAATTCAA
GAAATTAAATCAAATCGACGATCCAGAAGGCTGGATTGATTAATTTCCCATTATCGATGA
AAAAAATTGAAAAAAAAAGAGAGATGGATGAAGACTCAGTGGCATAGCGTGGATTTATCC
GAAACTGAAACCTCTTCATCAAGCAAGAGTGCAGCTAAGGTGGACTAATTGGATGCATGA
TGATCTCCATCCCAGCTAAGCATGGGGGTTCTTAATTAATTCAGCTATAATATAATTTTC
AACAGCCATGCATGCAGCAGCAGCTAAGATGTGATCTTTCTAGGGGTAGATTTGTTACTT
ATTTGTTCTTAAATTCTCAAGAGGATTCTAACCAGGTTATTAATTATTTTCAGAGGTTTT
TAAGTGGTACTATACTACTACTGCTACTTAGATTATTTTGCTGAGAGAGAAAAGAGTAGC
AGTACAGTAGCACCACAATTTGCTCATTTGTATAAAGGGGAACGCATGATTTGAGTGGGC
ATCTGGTGTCGTTTTTAATCCTGATCTCG

CDS

759 bp

>Os02t0557800-02 A-type response regulator, Cytokinin signaling
ATGGGAGCGGAGGCGGTGAGGGTGCTGGTGGTGGACGACTCGCCGGTGGACAGGCGGGTC
GTGGAGCTGCTTCTCCGGGCGCACTGCGGCGGCGGCGGCGGCGCCGCCGCCGGCGAGGCG
GCTCCGTTCCACGTCACCGCCGTGGACAGCGGCAAGAAGGCGATGGAGCTGCTCGGCCGG
CGGCGGGGGGACCGGGACCACCTCACCCCATCCTCTCCGGCGGCGGCGGCGGCGGCCAAC
GATCAAGCGATCGACATCGTGCTGACCGACTACTGCATGCCGGAGATGACAGGATACGAT
CTTCTCAAAGCCATCAAGGCGTTGGGGTCGCCGAATCCGATCCCGGTGGTGGTCATGTCG
TCGGAGAATGAGCCCCAGAGGATCAGCAGATGCTTGACAGCCGGTGCCGAGGATTTCATC
CTTAAGCCTCTCAAGATGAACGATGTCCAGCGCCTCCGGAAATGCTCCGGCGCCACCAGG
CCGAAGTCCGCCGTCGCCGGAGACGATGACCGGTGCTGCAACACGGCCAAGAAGGCGGCG
GCGGCGGCCGCAGCCACACCGGAGCAGCAGCAGCAGCAGCAGAGATCGTCGCACCTGGCA
GGACTAGCCATGGTGATGAATGCATCCAGCTTCGAGGTGTCGCACTACTTCCAGCTCATC
TTCAAGCTCATCCTGCTCGCCTACGCCGTGCTGTGCCTCAGCCAGCTCCTGCACAGATGG
TCCAATGGCAGCAGCCTCCTCTCCCTGTGGTGCGCATGA

Protein

252 aa

>Os02t0557800-02 A-type response regulator, Cytokinin signaling
MGAEAVRVLVVDDSPVDRRVVELLLRAHCGGGGGAAAGEAAPFHVTAVDSGKKAMELLGR
RRGDRDHLTPSSPAAAAAANDQAIDIVLTDYCMPEMTGYDLLKAIKALGSPNPIPVVVMS
SENEPQRISRCLTAGAEDFILKPLKMNDVQRLRKCSGATRPKSAVAGDDDRCCNTAKKAA
AAAAATPEQQQQQQRSSHLAGLAMVMNASSFEVSHYFQLIFKLILLAYAVLCLSQLLHRW
SNGSSLLSLWCA*

5'UTR

chr02:21131206..21131340 (- strand) : 135 bp

CDS

chr02:21131073..21131205 (- strand) : 133 bp

chr02:21130875..21130981 (- strand) : 107 bp

chr02:21130418..21130495 (- strand) : 78 bp

chr02:21130239..21130309 (- strand) : 71 bp

chr02:21129778..21130001 (- strand) : 224 bp

chr02:21129391..21129536 (- strand) : 146 bp

3'UTR

chr02:21128876..21129390 (- strand) : 515 bp

FASTA

>Os02t0557800-02 class=Sequence position=chr02:21128876..21131340 (- strand)
GCGCGGGCGG CGAGGCGAGG GCGTCGCGAT TCCTCCTCTT TCAAATACTC CCACGGCGAG GACCGCGGCG AGGGCGCGCG
GGCCATTGCT GCTGCTTCTT CTGCTGCTGC GTGTGTGTGG GTGAGACCTG AGAGGATGGG AGCGGAGGCG GTGAGGGTGC
TGGTGGTGGA CGACTCGCCG GTGGACAGGC GGGTCGTGGA GCTGCTTCTC CGGGCGCACT GCGGCGGCGG CGGCGGCGCC
GCCGCCGGCG AGGCGGCTCC GTTCCACGGT GAGCGCTACC GTCTCTTTTG GTTCTTTGCT CCTTTGCTCG CCTCGCCGCC
GACGCATGAT CGTTTGCTGG CTTTTCCTCG ATCCTCCAGT CACCGCCGTG GACAGCGGCA AGAAGGCGAT GGAGCTGCTC
GGCCGGCGGC GGGGGGACCG GGACCACCTC ACCCCATCCT CTCCGGCGGC GGCGGCGGCG GCCAACGTAC GTCACCCATC
ACCATACACT GCATTGCAGA TGAGCCATTT GATTTTTCAT CACCTGATAT AGGAGTGTTC ATCAATTCTG AACGAACTCG
GTCTCTCTCA CCCCCTCCTC TGACACAAAG TCTAACTCGC TCTGTTCTTT CTCTGTTCCT CGGAGAGAAA TTTAATCCCT
TCACTAATCA TCACTAGCAG AGCAACAGTG CGGTAGTTTG AATGTCTGAT GAGTTCTTTG ATGAAACTCA TGTTGCCGTA
CAGTGCAAAA TGCCTACGTA GTGCCACATC AAATTGGAGA TGAATCTTTT GTCATTTCTT TTTTACCCTT TTCGATTTAG
TCTGAAACTA GAGAGATGAA AATGAGAATG GACAAATCTT TGCAGGATCA AGCGATCGAC ATCGTGCTGA CCGACTACTG
CATGCCGGAG ATGACAGGAT ACGATCTTCT CAAAGCCATC AAGGTTGAGC GATGAAGAGC ATGTGAAACT TCTTCAAAGA
TTCTCTTTTC TGTTTCTGTT TTTGTCAGTT CAAATGTAAA TTTGAGCATC TGAATTTCTG AATCTACTCA GGCGTTGGGG
TCGCCGAATC CGATCCCGGT GGTGGTCATG TCGTCGGAGA ATGAGCCCCA GAGGATCAGC AGGTGAAGTT CTTGGCACCC
ATTCTTTCTC CTCTTCTTTG CAAAACCATC ATCAATCAAC TCGTTTGCAA AGCTGAAGAT ACTGTTTTTG TTTTTGTATA
TTGATGAAAG TTGCTTTTGC AACTGTGGCT TCTCTCCGAA AGCCAAGATT TGCACAGCTT TTCAGATTCA AAAGTCGGAT
TTGTGTGTGT GTGCATCACC ACTAACGCTA ACATGTATGT CCTCTTTTGG TTAAAGCAGA TGCTTGACAG CCGGTGCCGA
GGATTTCATC CTTAAGCCTC TCAAGATGAA CGATGTCCAG CGCCTCCGGA AATGCTCCGG CGCCACCAGG CCGAAGTCCG
CCGTCGCCGG AGACGATGAC CGGTGCTGCA ACACGGCCAA GAAGGCGGCG GCGGCGGCCG CAGCCACACC GGAGCAGCAG
CAGCAGCAGC AGAGATCGTC GCACCTGGCA GGACTAGCCA TGGCATGATC CCTTTTCTTC TCAAATGCAT ATCAAATTAA
CCTTTTGATC AAACATGTCA TACGACGATA TACCTCATAC tacctcatac tacctagata ccaagaggta ccaaatttat
aatagaaaaa gtggtacatc atgatacctc ctcaagtaac gtaaaattgc tctaaTTATA TATGCTGCGG TGATCATTGG
TTAATTTGTG GATTTTTGTT TTCTTGTTTT TTGGTTTTTG CAGGTGATGA ATGCATCCAG CTTCGAGGTG TCGCACTACT
TCCAGCTCAT CTTCAAGCTC ATCCTGCTCG CCTACGCCGT GCTGTGCCTC AGCCAGCTCC TGCACAGATG GTCCAATGGC
AGCAGCCTCC TCTCCCTGTG GTGCGCATGA ATTCAAGAAA TTAAATCAAA TCGACGATCC AGAAGGCTGG ATTGATTAAT
TTCCCATTAT CGATGAAAAA AATTGAAAAA AAAAGAGAGA TGGATGAAGA CTCAGTGGCA TAGCGTGGAT TTATCCGAAA
CTGAAACCTC TTCATCAAGC AAGAGTGCAG CTAAGGTGGA CTAATTGGAT GCATGATGAT CTCCATCCCA GCTAAGCATG
GGGGTTCTTA ATTAATTCAG CTATAATATA ATTTTCAACA GCCATGCATG CAGCAGCAGC TAAGATGTGA TCTTTCTAGG
GGTAGATTTG TTACTTATTT GTTCTTAAAT TCTCAAGAGG ATTCTAACCA GGTTATTAAT TATTTTCAGA GGTTTTTAAG
TGGTACTATA CTACTACTGC TACTTAGATT ATTTTGCTGA GAGAGAAAAG AGTAGCAGTA CAGTAGCACC ACAATTTGCT
CATTTGTATA AAGGGGAACG CATGATTTGA GTGGGCATCT GGTGTCGTTT TTAATCCTGA TCTCG

Locus: Os02g0557800

Loading...

Locus: Os02g0557800

Loading...