Os02t0561400-01

Locus

Os02g0561400

Description

RING-H2 type E3 ubiquitin ligase, Root development, Maintenance of cell viability after the initiation of root primordial formation, Defense response

RAP-DB Gene Symbol Synonym(s)

EL5, EL5.5

RAP-DB Gene Name Synonym(s)

ELICITOR 5, E3 ubiquitin-protein ligase EL5

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AB045120

AK243670

Protein Evidence

Q9LRB7

Literature

PMID: 17559513

PMID: 12028574

PMID: 11448732

Note

Manual Curation

April 6, 2016

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J100089N18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0561400-01)

Others

KEGG (Os02t0561400-01)

Transcript

1261 bp

>Os02t0561400-01 RING-H2 type E3 ubiquitin ligase, Root development, Maintenance of cell viability after the initiation of root primordial formation, Defense response
GGTCACATATGCATGTGACGGTCGATTATTATGGTGCGGGGTGTCGAGCAGGGCGGCCCC
GCCATGGACGAGTCTTCGTCGTCGTCGTCGCCGTCGCCGGTGTCCGCGCCTGCAGGGCAG
GCAGCCATGACGGCCGGCGGCATCGCCACCGTGGCGGCCGTGCTCATCGTCTTCGCGGCG
CTCACGCTCGCCTTCGTCCTGCTCCAGTGCTACTGCGACGAGCGGCGCCGCGCCGTGACG
ACGACgtcgacgagcgggcgcgggcggcggccgcggccgcggcggcgctctgggagcggc
ggggacggtggaacgggaggaggggtcgacccggaggtgctccggtcgctgccggtcacg
gtgtacagccgcagcacggcggcggcggcggcgaaggaggaggaggaggaggacgacgac
ggcgtcgagtgcgcggtgtgcctcgcggagctcgaggacggcgAGGAGGCCAGGTTCCTC
CCCCGGTGCGGCCACGGCTTCCACGCCGAGTGCGTCGACATGTGGCTCGGCTCCCACTCC
ACCTGCCCGCTCTGCCGCCTCACCGTCGTCGTGCCGCCGCCGCCTCTTCCTCCCGTCCCG
CCGGAGCCGCCGGCGAGCTACACCGTGAGCCTCCCGGCGAGCGTCCTGCTCGGCCTGTCC
GACCATGGCGCCGGCGCGGTGACCATGACAGCGGAGGGCCGCAGCACGCTGGTGATCGAG
ATCCCCGAATCCGCGGCTTCGACGACCCCGCGCGACGCGGCGGCGAGGTCGTCGCCGAGC
TTGGCGCGGCTGAGGTCACTGAGAAGGCTCTGGAGCTTCGGGCGGCAAGGGGCGGCGGGG
TCGACGTCGTCATGCTCCTGCGCCACCGGAGGAGACAACGACGACGGCGACGTCGAGCAC
GGTGTCAGCGTCACCGTCGCCATCCGCGCCGTGGAGGCGGCAACGCCGGCACGGCCACCG
GAGGCCGAGGCCGGTGCAAGAACCGCCGCCGCGCATGTCCGGAATTGACGGCGGCGAGGT
CGTCAAGTATTATAAGGCGATCTCCCTGTACATATCGGTAGAACCGAACTGGAATCGCCA
ttaattcctacgattttagaaaatatcaatttcatttttaagattagaaacatttaagta
gaaattattTGTTCATCAGTCAAGTAGCAAAGAGAAATGTATGGATGGCAGTGAGAAGCA
TCCCTCTCCGTATGTTCCATGAATTGTGAGCCGAATATGAATTTCAGCCAAATCTTGACT
A

CDS

978 bp

>Os02t0561400-01 RING-H2 type E3 ubiquitin ligase, Root development, Maintenance of cell viability after the initiation of root primordial formation, Defense response
ATGGTGCGGGGTGTCGAGCAGGGCGGCCCCGCCATGGACGAGTCTTCGTCGTCGTCGTCG
CCGTCGCCGGTGTCCGCGCCTGCAGGGCAGGCAGCCATGACGGCCGGCGGCATCGCCACC
GTGGCGGCCGTGCTCATCGTCTTCGCGGCGCTCACGCTCGCCTTCGTCCTGCTCCAGTGC
TACTGCGACGAGCGGCGCCGCGCCGTGACGACGACgtcgacgagcgggcgcgggcggcgg
ccgcggccgcggcggcgctctgggagcggcggggacggtggaacgggaggaggggtcgac
ccggaggtgctccggtcgctgccggtcacggtgtacagccgcagcacggcggcggcggcg
gcgaaggaggaggaggaggaggacgacgacggcgtcgagtgcgcggtgtgcctcgcggag
ctcgaggacggcgAGGAGGCCAGGTTCCTCCCCCGGTGCGGCCACGGCTTCCACGCCGAG
TGCGTCGACATGTGGCTCGGCTCCCACTCCACCTGCCCGCTCTGCCGCCTCACCGTCGTC
GTGCCGCCGCCGCCTCTTCCTCCCGTCCCGCCGGAGCCGCCGGCGAGCTACACCGTGAGC
CTCCCGGCGAGCGTCCTGCTCGGCCTGTCCGACCATGGCGCCGGCGCGGTGACCATGACA
GCGGAGGGCCGCAGCACGCTGGTGATCGAGATCCCCGAATCCGCGGCTTCGACGACCCCG
CGCGACGCGGCGGCGAGGTCGTCGCCGAGCTTGGCGCGGCTGAGGTCACTGAGAAGGCTC
TGGAGCTTCGGGCGGCAAGGGGCGGCGGGGTCGACGTCGTCATGCTCCTGCGCCACCGGA
GGAGACAACGACGACGGCGACGTCGAGCACGGTGTCAGCGTCACCGTCGCCATCCGCGCC
GTGGAGGCGGCAACGCCGGCACGGCCACCGGAGGCCGAGGCCGGTGCAAGAACCGCCGCC
GCGCATGTCCGGAATTGA

Protein

325 aa

>Os02t0561400-01 RING-H2 type E3 ubiquitin ligase, Root development, Maintenance of cell viability after the initiation of root primordial formation, Defense response
MVRGVEQGGPAMDESSSSSSPSPVSAPAGQAAMTAGGIATVAAVLIVFAALTLAFVLLQC
YCDERRRAVTTTSTSGRGRRPRPRRRSGSGGDGGTGGGVDPEVLRSLPVTVYSRSTAAAA
AKEEEEEDDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV
VPPPPLPPVPPEPPASYTVSLPASVLLGLSDHGAGAVTMTAEGRSTLVIEIPESAASTTP
RDAAARSSPSLARLRSLRRLWSFGRQGAAGSTSSCSCATGGDNDDGDVEHGVSVTVAIRA
VEAATPARPPEAEAGARTAAAHVRN*

5'UTR

chr02:21287418..21287447 (- strand) : 30 bp

CDS

chr02:21286440..21287417 (- strand) : 978 bp

3'UTR

chr02:21286187..21286439 (- strand) : 253 bp

FASTA

>Os02t0561400-01 class=Sequence position=chr02:21286187..21287447 (- strand)
GGTCACATAT GCATGTGACG GTCGATTATT ATGGTGCGGG GTGTCGAGCA GGGCGGCCCC GCCATGGACG AGTCTTCGTC
GTCGTCGTCG CCGTCGCCGG TGTCCGCGCC TGCAGGGCAG GCAGCCATGA CGGCCGGCGG CATCGCCACC GTGGCGGCCG
TGCTCATCGT CTTCGCGGCG CTCACGCTCG CCTTCGTCCT GCTCCAGTGC TACTGCGACG AGCGGCGCCG CGCCGTGACG
ACGACgtcga cgagcgggcg cgggcggcgg ccgcggccgc ggcggcgctc tgggagcggc ggggacggtg gaacgggagg
aggggtcgac ccggaggtgc tccggtcgct gccggtcacg gtgtacagcc gcagcacggc ggcggcggcg gcgaaggagg
aggaggagga ggacgacgac ggcgtcgagt gcgcggtgtg cctcgcggag ctcgaggacg gcgAGGAGGC CAGGTTCCTC
CCCCGGTGCG GCCACGGCTT CCACGCCGAG TGCGTCGACA TGTGGCTCGG CTCCCACTCC ACCTGCCCGC TCTGCCGCCT
CACCGTCGTC GTGCCGCCGC CGCCTCTTCC TCCCGTCCCG CCGGAGCCGC CGGCGAGCTA CACCGTGAGC CTCCCGGCGA
GCGTCCTGCT CGGCCTGTCC GACCATGGCG CCGGCGCGGT GACCATGACA GCGGAGGGCC GCAGCACGCT GGTGATCGAG
ATCCCCGAAT CCGCGGCTTC GACGACCCCG CGCGACGCGG CGGCGAGGTC GTCGCCGAGC TTGGCGCGGC TGAGGTCACT
GAGAAGGCTC TGGAGCTTCG GGCGGCAAGG GGCGGCGGGG TCGACGTCGT CATGCTCCTG CGCCACCGGA GGAGACAACG
ACGACGGCGA CGTCGAGCAC GGTGTCAGCG TCACCGTCGC CATCCGCGCC GTGGAGGCGG CAACGCCGGC ACGGCCACCG
GAGGCCGAGG CCGGTGCAAG AACCGCCGCC GCGCATGTCC GGAATTGACG GCGGCGAGGT CGTCAAGTAT TATAAGGCGA
TCTCCCTGTA CATATCGGTA GAACCGAACT GGAATCGCCA ttaattccta cgattttaga aaatatcaat ttcattttta
agattagaaa catttaagta gaaattattT GTTCATCAGT CAAGTAGCAA AGAGAAATGT ATGGATGGCA GTGAGAAGCA
TCCCTCTCCG TATGTTCCAT GAATTGTGAG CCGAATATGA ATTTCAGCCA AATCTTGACT A

Locus: Os02g0561400

Loading...

Locus: Os02g0561400

Loading...