Os02t0569400-01

Locus

Os02g0569400

Description

Cytochrome P450 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP76M8

CGSNL Gene Name

P-450 76M8

Oryzabase Gene Symbol Synonym(s)

CYP76M8

Oryzabase Gene Name Synonym(s)

Cytochrome P450 76M8

Transcript Evidence

AK069701 (DDBJ, Best hit)

Protein Evidence

C8C9S7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

J023027B10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0569400-01)

RiceXPro (AK069701)

Others

Oryzabase (9871)

KEGG (Os02t0569400-01)

Transcript

1736 bp

>Os02t0569400-01 Cytochrome P450 family protein.
AGAGCACGAGCTTACCTAGCTAGGTCCAGAGAAAAAACTGATACAACGATAGTAACAATA
ACAGTAGATAGTGTGTTACTACTGCACGGTTCGTCGCAAACAATGGAGAATAGCCAGATG
TGGCTTCTGTGGGGAGCCCTCTCCGTGGCGCTCTTCTTCTACTTCTCCACCCTGCGACGA
CGCTACGCCGGCGGCAAGCCCCTCCCCCCGGGCCCGACGCCGCTGCCGCTCATCGGCAAC
CTACACTTGGTCGGCGGCGGCACGTTCCACCACAAGCTCAGGGACCTGGCACGCGTCCAC
GGCCCCGTCATGACGCTCAAGCTCGGACTCGCCACCAACGTGGTCATCTCCTCCCGGGAG
GCCGCCATCGAGGCGTACACCAAGTACGACCGCCACCTCGCCGCGCGCGCCACCCCGGAC
ACCTTCCGCGCCTGCGGCTTCGCCGACCGCTCCATGGTGTTCATCCCGAGCTCCGACCCG
CAGTGGAAGGCCCTGCGGGGGATCCACGCCTCGCACGTCTTCACCCCGCGGGTGCTCGCC
GCGGTGCGCCCCATCCGCGAGAGGAAGGTGGGCGACCTCATCGCCTACCTCCGCGCGCAC
GCCGGGGAGGAGGTGCTCGTCGGCCACGCCATGTACACGGGCATCCTCAACATGGTGTCC
TTCTCCTACTTCTCCGTCGACATCGTCGACATGGGCTCGCAGATGGCCCGCGAGCTGCGG
GAGGTGGTGGACGACATCATCTTGGTGGTCGGGAAGCCCAACGTGTCCGACTTCTACCCG
TTCCTCCGGCCGCTGGACCTGCAGGGCCTGCGCCGCTGGACGACGAAGCGGTTCAACAGG
GTGTTCTCCATCATGGGCGACATCATCGACCGCCGTTTGGCTCACATCCGCGACAACAAG
CCGAGGCACGACGACTTCCTCGACTCAATCCTCGAGCTCATGGCTGCCGGCAAGATCGAT
CGTGTCAACGTGCTCAACATGTTGTTCGAGGCTTTCGTTGCCGGGGCTGACACCATGGCT
CTTACCTTGGAGTGGGTAATGGCCGAGCTGCTCAAAAACCCGAGCGTGATGGCCAAGGCG
CGCGCCGAGCTGAGGGATGTGCTCGGCGACAAGGAGATCGTGGAGGAGGCCGACGCGGCG
AGGCTGCCCTACCTGCAGGCCGTGCTGAAGGAGGCCATGAGACTGCACCCGGTGGGCGCG
CTGCTGCTGCCGCACTTCGCCATGGAGGACGGCGTGGAGGTCGGCGGCTACGCGGTGCCC
AAGGGCTCCACGGTGCTCTTCAACGCGTGGGCGATCATGCGCGACGCGGCGGCGTGGGAG
AGGCCCGACGAGTTCGTGCCGGAGCGGTTCGTGGAGAGGACGCCGCAGCTGGACTTCAGA
GGGAAGGACGTGGAGTTCATGCCGTTCGGGTCCGGGAGGCGGCTGTGCCCTGGGCTGCCG
TTGGCCGAGCGTGTCGTGCCGTTCATTCTGGCGTCGATGCTGCACACGTTCGAGTGGGAG
CTCCCCGGCGGCATGACGGCGGAGGAGTTGGACGTGTCCGAGAAGTTCAAGACTGCCAAT
GTCCTTGCTGTGCCTCTCAAGGCTGTGCCTGTCCTGATCAAATAGTTGGACGACTATATT
ATTGGCCAGATCAATTACCATACTCGGCACCAGAATTATATTATTTTTAACGAATTTGTA
CTAGTGCACATTGAATAGAGAAGAAGCAAAACTATACAAGTATAAGCCTACACAGG

CDS

1503 bp

>Os02t0569400-01 Cytochrome P450 family protein.
ATGGAGAATAGCCAGATGTGGCTTCTGTGGGGAGCCCTCTCCGTGGCGCTCTTCTTCTAC
TTCTCCACCCTGCGACGACGCTACGCCGGCGGCAAGCCCCTCCCCCCGGGCCCGACGCCG
CTGCCGCTCATCGGCAACCTACACTTGGTCGGCGGCGGCACGTTCCACCACAAGCTCAGG
GACCTGGCACGCGTCCACGGCCCCGTCATGACGCTCAAGCTCGGACTCGCCACCAACGTG
GTCATCTCCTCCCGGGAGGCCGCCATCGAGGCGTACACCAAGTACGACCGCCACCTCGCC
GCGCGCGCCACCCCGGACACCTTCCGCGCCTGCGGCTTCGCCGACCGCTCCATGGTGTTC
ATCCCGAGCTCCGACCCGCAGTGGAAGGCCCTGCGGGGGATCCACGCCTCGCACGTCTTC
ACCCCGCGGGTGCTCGCCGCGGTGCGCCCCATCCGCGAGAGGAAGGTGGGCGACCTCATC
GCCTACCTCCGCGCGCACGCCGGGGAGGAGGTGCTCGTCGGCCACGCCATGTACACGGGC
ATCCTCAACATGGTGTCCTTCTCCTACTTCTCCGTCGACATCGTCGACATGGGCTCGCAG
ATGGCCCGCGAGCTGCGGGAGGTGGTGGACGACATCATCTTGGTGGTCGGGAAGCCCAAC
GTGTCCGACTTCTACCCGTTCCTCCGGCCGCTGGACCTGCAGGGCCTGCGCCGCTGGACG
ACGAAGCGGTTCAACAGGGTGTTCTCCATCATGGGCGACATCATCGACCGCCGTTTGGCT
CACATCCGCGACAACAAGCCGAGGCACGACGACTTCCTCGACTCAATCCTCGAGCTCATG
GCTGCCGGCAAGATCGATCGTGTCAACGTGCTCAACATGTTGTTCGAGGCTTTCGTTGCC
GGGGCTGACACCATGGCTCTTACCTTGGAGTGGGTAATGGCCGAGCTGCTCAAAAACCCG
AGCGTGATGGCCAAGGCGCGCGCCGAGCTGAGGGATGTGCTCGGCGACAAGGAGATCGTG
GAGGAGGCCGACGCGGCGAGGCTGCCCTACCTGCAGGCCGTGCTGAAGGAGGCCATGAGA
CTGCACCCGGTGGGCGCGCTGCTGCTGCCGCACTTCGCCATGGAGGACGGCGTGGAGGTC
GGCGGCTACGCGGTGCCCAAGGGCTCCACGGTGCTCTTCAACGCGTGGGCGATCATGCGC
GACGCGGCGGCGTGGGAGAGGCCCGACGAGTTCGTGCCGGAGCGGTTCGTGGAGAGGACG
CCGCAGCTGGACTTCAGAGGGAAGGACGTGGAGTTCATGCCGTTCGGGTCCGGGAGGCGG
CTGTGCCCTGGGCTGCCGTTGGCCGAGCGTGTCGTGCCGTTCATTCTGGCGTCGATGCTG
CACACGTTCGAGTGGGAGCTCCCCGGCGGCATGACGGCGGAGGAGTTGGACGTGTCCGAG
AAGTTCAAGACTGCCAATGTCCTTGCTGTGCCTCTCAAGGCTGTGCCTGTCCTGATCAAA
TAG

Protein

501 aa

>Os02t0569400-01 Cytochrome P450 family protein.
MENSQMWLLWGALSVALFFYFSTLRRRYAGGKPLPPGPTPLPLIGNLHLVGGGTFHHKLR
DLARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVF
IPSSDPQWKALRGIHASHVFTPRVLAAVRPIRERKVGDLIAYLRAHAGEEVLVGHAMYTG
ILNMVSFSYFSVDIVDMGSQMARELREVVDDIILVVGKPNVSDFYPFLRPLDLQGLRRWT
TKRFNRVFSIMGDIIDRRLAHIRDNKPRHDDFLDSILELMAAGKIDRVNVLNMLFEAFVA
GADTMALTLEWVMAELLKNPSVMAKARAELRDVLGDKEIVEEADAARLPYLQAVLKEAMR
LHPVGALLLPHFAMEDGVEVGGYAVPKGSTVLFNAWAIMRDAAAWERPDEFVPERFVERT
PQLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWELPGGMTAEELDVSE
KFKTANVLAVPLKAVPVLIK*

5'UTR

chr02:21690378..21690479 (+ strand) : 102 bp

CDS

chr02:21690480..21691982 (+ strand) : 1503 bp

3'UTR

chr02:21691983..21692113 (+ strand) : 131 bp

FASTA

>Os02t0569400-01 class=Sequence position=chr02:21690378..21692113 (+ strand)
AGAGCACGAG CTTACCTAGC TAGGTCCAGA GAAAAAACTG ATACAACGAT AGTAACAATA ACAGTAGATA GTGTGTTACT
ACTGCACGGT TCGTCGCAAA CAATGGAGAA TAGCCAGATG TGGCTTCTGT GGGGAGCCCT CTCCGTGGCG CTCTTCTTCT
ACTTCTCCAC CCTGCGACGA CGCTACGCCG GCGGCAAGCC CCTCCCCCCG GGCCCGACGC CGCTGCCGCT CATCGGCAAC
CTACACTTGG TCGGCGGCGG CACGTTCCAC CACAAGCTCA GGGACCTGGC ACGCGTCCAC GGCCCCGTCA TGACGCTCAA
GCTCGGACTC GCCACCAACG TGGTCATCTC CTCCCGGGAG GCCGCCATCG AGGCGTACAC CAAGTACGAC CGCCACCTCG
CCGCGCGCGC CACCCCGGAC ACCTTCCGCG CCTGCGGCTT CGCCGACCGC TCCATGGTGT TCATCCCGAG CTCCGACCCG
CAGTGGAAGG CCCTGCGGGG GATCCACGCC TCGCACGTCT TCACCCCGCG GGTGCTCGCC GCGGTGCGCC CCATCCGCGA
GAGGAAGGTG GGCGACCTCA TCGCCTACCT CCGCGCGCAC GCCGGGGAGG AGGTGCTCGT CGGCCACGCC ATGTACACGG
GCATCCTCAA CATGGTGTCC TTCTCCTACT TCTCCGTCGA CATCGTCGAC ATGGGCTCGC AGATGGCCCG CGAGCTGCGG
GAGGTGGTGG ACGACATCAT CTTGGTGGTC GGGAAGCCCA ACGTGTCCGA CTTCTACCCG TTCCTCCGGC CGCTGGACCT
GCAGGGCCTG CGCCGCTGGA CGACGAAGCG GTTCAACAGG GTGTTCTCCA TCATGGGCGA CATCATCGAC CGCCGTTTGG
CTCACATCCG CGACAACAAG CCGAGGCACG ACGACTTCCT CGACTCAATC CTCGAGCTCA TGGCTGCCGG CAAGATCGAT
CGTGTCAACG TGCTCAACAT GTTGTTCGAG GCTTTCGTTG CCGGGGCTGA CACCATGGCT CTTACCTTGG AGTGGGTAAT
GGCCGAGCTG CTCAAAAACC CGAGCGTGAT GGCCAAGGCG CGCGCCGAGC TGAGGGATGT GCTCGGCGAC AAGGAGATCG
TGGAGGAGGC CGACGCGGCG AGGCTGCCCT ACCTGCAGGC CGTGCTGAAG GAGGCCATGA GACTGCACCC GGTGGGCGCG
CTGCTGCTGC CGCACTTCGC CATGGAGGAC GGCGTGGAGG TCGGCGGCTA CGCGGTGCCC AAGGGCTCCA CGGTGCTCTT
CAACGCGTGG GCGATCATGC GCGACGCGGC GGCGTGGGAG AGGCCCGACG AGTTCGTGCC GGAGCGGTTC GTGGAGAGGA
CGCCGCAGCT GGACTTCAGA GGGAAGGACG TGGAGTTCAT GCCGTTCGGG TCCGGGAGGC GGCTGTGCCC TGGGCTGCCG
TTGGCCGAGC GTGTCGTGCC GTTCATTCTG GCGTCGATGC TGCACACGTT CGAGTGGGAG CTCCCCGGCG GCATGACGGC
GGAGGAGTTG GACGTGTCCG AGAAGTTCAA GACTGCCAAT GTCCTTGCTG TGCCTCTCAA GGCTGTGCCT GTCCTGATCA
AATAGTTGGA CGACTATATT ATTGGCCAGA TCAATTACCA TACTCGGCAC CAGAATTATA TTATTTTTAA CGAATTTGTA
CTAGTGCACA TTGAATAGAG AAGAAGCAAA ACTATACAAG TATAAGCCTA CACAGG

Locus: Os02g0569400

Loading...

Locus: Os02g0569400

Loading...