Os02t0569900-01

Locus

Os02g0569900

Description

Cytochrome P450 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP76M7

CGSNL Gene Name

P-450 76M7

Oryzabase Gene Symbol Synonym(s)

OsCYP76M7, CYP76M10, OsCYP76M10

Oryzabase Gene Name Synonym(s)

Cytochrome P450 76M7

Transcript Evidence

AK105913 (DDBJ, Best hit)

Protein Evidence

C8C9S7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

001-204-H06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0569900-01)

RiceXPro (AK105913)

Others

Oryzabase (9870)

KEGG (Os02t0569900-01)

Transcript

1657 bp

>Os02t0569900-01 Cytochrome P450 family protein.
AGGTAGAACCAGAGAAAAAGAACATTAACGATAAGTAAAGTAATGGAGAATAGCCAGGTG
TGGCTGCTATGGGGAGCTCTCTCCGTCGCTGTCCTCTTCTACCTCTCCACCCTGCGACGA
CGCTACGCCGGCGGCAAACCCCTCCCCCCGGGCCCGACGCCACTGCCGCTCATCGGCAAC
CTCCACCTGGCCGGCGGCACGTTCCACCACAAGCTCAGGGACCTGGCGCGCGTCCACGGC
CCCGTGATGACGCTCAAGCTCGGCCTCGCCACCAACGTGGTCATCTCCTCCCGGGAGGCC
GCCATCGAGGCGTACACCAAGTACGACCGCCACCTCGCCGCGCGCGCCACTCCGGACACC
TTCCGCGCGTGCGGCTTCGCCGACCGCTCCATGGTGTTCATCCCGAGCTCCGACCCGCAG
TGGAAGGCCCTGCGCGGGATCCAGGGCTCCCACGTCTTCACCCCGCGTGGCCTTGCCGCC
GTGCGCCCCATCCGTGAGCGGAAGGTGGGCGACCTCATCGCCTACCTCCGCGCGCACGCC
GGCGAGGAGGTGCTCCTCGGCCAGGCCATGTACACTGGCCTCCTCAACCTCGTGTCCTTC
TCCTACTTCTCCATCGACATCGTCGACATGGGCTCGCAGATGGCCCGCGACCTGCGGGAG
GTGGTGGACGACATCATCTCGGTGGTCGGGAAGCCCAACATCTCCGACTTCTACCCGTTC
CTCCGGCCGCTGGACCTGCAGGGCCTGCGCCGCTGGACGACGAAGCGGTTCAACAGGGTG
TTCTCCATCATGGGCGACATCATCGACCGCCGCCTGGCTCACATCCGCGACGGCAAGCCG
AGGCACGACGACTTCCTCGACTCGCTCCTCGAGCTCATGGCCACCGGCAAGATGGAGCGT
GTCAACGTGGTGAACATGCTGTTCGAGGCCTTCGTCGCCGGCGTGGACACCATGGCCCTC
ACCCTGGAGTGGGTGATGGCCGAGCTGCTCCACAACCCGGCCATCATGGCGAGGGTGCGC
GCGGAGCTGAGCGACGTGCTCGGCGGGAAGGAGGCCGTGGAGGAGGCCGACGCGGCGAGG
CTGCCCTACCTCCAGGCCGTGCTGAAGGAGGCCATGAGGCTGCACCCGGTGGGCGCGCTG
CTGCTGCCGCACTTCGCCGCGGAGGACGGCGTGGAGATCGGCGGCTACGCGGTGCCGAGG
GGCTCCACGGTGCTCTTCAACGCGTGGGCGATCATGCGCGACCCGGCGGCGTGGGAGAGG
CCCGACGAGTTCGTGCCGGAGCGCTTCCTGGGGAGGTCACCCCCGCTGGACTTCAGGGGG
AAGGACGTGGAGTTCATGCCGTTCGGGTCCGGGAGGCGGCTGTGCCCCGGGCTGCCGCTG
GCGGAGCGCGTCGTGCCGTTCATCCTGGCGTCGATGCTGCACACGTTCGAGTGGAAGCTC
CCCGGCGGCATGACGGCGGAGGACGTGGACGTGTCCGAGAAGTTCAAGTCTGCCAATGTG
CTTGCCGTGCCTCTCAAGGCCGTGCCTGTCCTGATCAAATAGTCGGACGTACGACTATAT
TGTTAGCCAGGTCATTAATTGTTCCAGAGTACTTTGGTTTCACTATATATATACGGGACC
CAGTGGCACGAGAATAATATGCATATGCATATATATG

CDS

1500 bp

>Os02t0569900-01 Cytochrome P450 family protein.
ATGGAGAATAGCCAGGTGTGGCTGCTATGGGGAGCTCTCTCCGTCGCTGTCCTCTTCTAC
CTCTCCACCCTGCGACGACGCTACGCCGGCGGCAAACCCCTCCCCCCGGGCCCGACGCCA
CTGCCGCTCATCGGCAACCTCCACCTGGCCGGCGGCACGTTCCACCACAAGCTCAGGGAC
CTGGCGCGCGTCCACGGCCCCGTGATGACGCTCAAGCTCGGCCTCGCCACCAACGTGGTC
ATCTCCTCCCGGGAGGCCGCCATCGAGGCGTACACCAAGTACGACCGCCACCTCGCCGCG
CGCGCCACTCCGGACACCTTCCGCGCGTGCGGCTTCGCCGACCGCTCCATGGTGTTCATC
CCGAGCTCCGACCCGCAGTGGAAGGCCCTGCGCGGGATCCAGGGCTCCCACGTCTTCACC
CCGCGTGGCCTTGCCGCCGTGCGCCCCATCCGTGAGCGGAAGGTGGGCGACCTCATCGCC
TACCTCCGCGCGCACGCCGGCGAGGAGGTGCTCCTCGGCCAGGCCATGTACACTGGCCTC
CTCAACCTCGTGTCCTTCTCCTACTTCTCCATCGACATCGTCGACATGGGCTCGCAGATG
GCCCGCGACCTGCGGGAGGTGGTGGACGACATCATCTCGGTGGTCGGGAAGCCCAACATC
TCCGACTTCTACCCGTTCCTCCGGCCGCTGGACCTGCAGGGCCTGCGCCGCTGGACGACG
AAGCGGTTCAACAGGGTGTTCTCCATCATGGGCGACATCATCGACCGCCGCCTGGCTCAC
ATCCGCGACGGCAAGCCGAGGCACGACGACTTCCTCGACTCGCTCCTCGAGCTCATGGCC
ACCGGCAAGATGGAGCGTGTCAACGTGGTGAACATGCTGTTCGAGGCCTTCGTCGCCGGC
GTGGACACCATGGCCCTCACCCTGGAGTGGGTGATGGCCGAGCTGCTCCACAACCCGGCC
ATCATGGCGAGGGTGCGCGCGGAGCTGAGCGACGTGCTCGGCGGGAAGGAGGCCGTGGAG
GAGGCCGACGCGGCGAGGCTGCCCTACCTCCAGGCCGTGCTGAAGGAGGCCATGAGGCTG
CACCCGGTGGGCGCGCTGCTGCTGCCGCACTTCGCCGCGGAGGACGGCGTGGAGATCGGC
GGCTACGCGGTGCCGAGGGGCTCCACGGTGCTCTTCAACGCGTGGGCGATCATGCGCGAC
CCGGCGGCGTGGGAGAGGCCCGACGAGTTCGTGCCGGAGCGCTTCCTGGGGAGGTCACCC
CCGCTGGACTTCAGGGGGAAGGACGTGGAGTTCATGCCGTTCGGGTCCGGGAGGCGGCTG
TGCCCCGGGCTGCCGCTGGCGGAGCGCGTCGTGCCGTTCATCCTGGCGTCGATGCTGCAC
ACGTTCGAGTGGAAGCTCCCCGGCGGCATGACGGCGGAGGACGTGGACGTGTCCGAGAAG
TTCAAGTCTGCCAATGTGCTTGCCGTGCCTCTCAAGGCCGTGCCTGTCCTGATCAAATAG

Protein

500 aa

>Os02t0569900-01 Cytochrome P450 family protein.
MENSQVWLLWGALSVAVLFYLSTLRRRYAGGKPLPPGPTPLPLIGNLHLAGGTFHHKLRD
LARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVFI
PSSDPQWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLIAYLRAHAGEEVLLGQAMYTGL
LNLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWTT
KRFNRVFSIMGDIIDRRLAHIRDGKPRHDDFLDSLLELMATGKMERVNVVNMLFEAFVAG
VDTMALTLEWVMAELLHNPAIMARVRAELSDVLGGKEAVEEADAARLPYLQAVLKEAMRL
HPVGALLLPHFAAEDGVEIGGYAVPRGSTVLFNAWAIMRDPAAWERPDEFVPERFLGRSP
PLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWKLPGGMTAEDVDVSEK
FKSANVLAVPLKAVPVLIK*

5'UTR

chr02:21740304..21740345 (+ strand) : 42 bp

CDS

chr02:21740346..21741845 (+ strand) : 1500 bp

3'UTR

chr02:21741846..21741960 (+ strand) : 115 bp

FASTA

>Os02t0569900-01 class=Sequence position=chr02:21740304..21741960 (+ strand)
AGGTAGAACC AGAGAAAAAG AACATTAACG ATAAGTAAAG TAATGGAGAA TAGCCAGGTG TGGCTGCTAT GGGGAGCTCT
CTCCGTCGCT GTCCTCTTCT ACCTCTCCAC CCTGCGACGA CGCTACGCCG GCGGCAAACC CCTCCCCCCG GGCCCGACGC
CACTGCCGCT CATCGGCAAC CTCCACCTGG CCGGCGGCAC GTTCCACCAC AAGCTCAGGG ACCTGGCGCG CGTCCACGGC
CCCGTGATGA CGCTCAAGCT CGGCCTCGCC ACCAACGTGG TCATCTCCTC CCGGGAGGCC GCCATCGAGG CGTACACCAA
GTACGACCGC CACCTCGCCG CGCGCGCCAC TCCGGACACC TTCCGCGCGT GCGGCTTCGC CGACCGCTCC ATGGTGTTCA
TCCCGAGCTC CGACCCGCAG TGGAAGGCCC TGCGCGGGAT CCAGGGCTCC CACGTCTTCA CCCCGCGTGG CCTTGCCGCC
GTGCGCCCCA TCCGTGAGCG GAAGGTGGGC GACCTCATCG CCTACCTCCG CGCGCACGCC GGCGAGGAGG TGCTCCTCGG
CCAGGCCATG TACACTGGCC TCCTCAACCT CGTGTCCTTC TCCTACTTCT CCATCGACAT CGTCGACATG GGCTCGCAGA
TGGCCCGCGA CCTGCGGGAG GTGGTGGACG ACATCATCTC GGTGGTCGGG AAGCCCAACA TCTCCGACTT CTACCCGTTC
CTCCGGCCGC TGGACCTGCA GGGCCTGCGC CGCTGGACGA CGAAGCGGTT CAACAGGGTG TTCTCCATCA TGGGCGACAT
CATCGACCGC CGCCTGGCTC ACATCCGCGA CGGCAAGCCG AGGCACGACG ACTTCCTCGA CTCGCTCCTC GAGCTCATGG
CCACCGGCAA GATGGAGCGT GTCAACGTGG TGAACATGCT GTTCGAGGCC TTCGTCGCCG GCGTGGACAC CATGGCCCTC
ACCCTGGAGT GGGTGATGGC CGAGCTGCTC CACAACCCGG CCATCATGGC GAGGGTGCGC GCGGAGCTGA GCGACGTGCT
CGGCGGGAAG GAGGCCGTGG AGGAGGCCGA CGCGGCGAGG CTGCCCTACC TCCAGGCCGT GCTGAAGGAG GCCATGAGGC
TGCACCCGGT GGGCGCGCTG CTGCTGCCGC ACTTCGCCGC GGAGGACGGC GTGGAGATCG GCGGCTACGC GGTGCCGAGG
GGCTCCACGG TGCTCTTCAA CGCGTGGGCG ATCATGCGCG ACCCGGCGGC GTGGGAGAGG CCCGACGAGT TCGTGCCGGA
GCGCTTCCTG GGGAGGTCAC CCCCGCTGGA CTTCAGGGGG AAGGACGTGG AGTTCATGCC GTTCGGGTCC GGGAGGCGGC
TGTGCCCCGG GCTGCCGCTG GCGGAGCGCG TCGTGCCGTT CATCCTGGCG TCGATGCTGC ACACGTTCGA GTGGAAGCTC
CCCGGCGGCA TGACGGCGGA GGACGTGGAC GTGTCCGAGA AGTTCAAGTC TGCCAATGTG CTTGCCGTGC CTCTCAAGGC
CGTGCCTGTC CTGATCAAAT AGTCGGACGT ACGACTATAT TGTTAGCCAG GTCATTAATT GTTCCAGAGT ACTTTGGTTT
CACTATATAT ATACGGGACC CAGTGGCACG AGAATAATAT GCATATGCAT ATATATG