Os02t0571100-01

Locus

Os02g0571100

Description

Ent-copalyl diphosphate synthase, Defense against both fungal pathogen and bacterial pathogen, Biosynthesis of phytoalexin

RAP-DB Gene Symbol Synonym(s)

OsCPS2, Os-CPS2, OsCyc2, OsCPS2ent

RAP-DB Gene Name Synonym(s)

ent-CPP synthase, ent-copalyl diphosphate synthase, ent-CDP synthase

CGSNL Gene Symbol

CPS2

CGSNL Gene Name

ENT-COPALYL DIPHOSPHATE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

OsCPS2, cps2, OsCPS2ent, CYC2, OsCyc2, OsCYC2, OsCPSL1, cpsl1, OsCyc2/OsCPS2, OsTPS7, Os-CPS2

Oryzabase Gene Name Synonym(s)

rice ent-copalyl diphosphate (CDP) synthase2, ent-copalyl diphosphate synthase 2, Ent-CDP synthase 2, ent-copalyl diphosphate synthase like 1, cyclase2, cyclase 2, ent-CDP synthase, terpene synthase 7

Transcript Evidence

AK072928 (truncated)

AB066271

AY602991 (IR24)

Protein Evidence

Q6Z5I0

Literature

PMID: 29691314

PMID: 15542489

PMID: 15341631

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 12, 2018

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: terpene synthase activity (GO:0010333)

Molecular Function: lyase activity (GO:0016829)

Functional domain (InterPro)

Terpene synthase, N-terminal domain superfamily (IPR036965)

Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid (IPR008930)

Isoprenoid synthase domain superfamily (IPR008949)

Terpene synthase, N-terminal domain (IPR001906)

Terpene synthase, metal-binding domain (IPR005630)

Full-length cDNA

J023144G04(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os02t0571100-01)

RiceXPro (AK072928)

Others

Oryzabase (3128)

KEGG (Os02t0571100-01 (EC:5.5.1.13))

Transcript

2712 bp

>Os02t0571100-01 Ent-copalyl diphosphate synthase, Defense against both fungal pathogen and bacterial pathogen, Biosynthesis of phytoalexin
CGGTGATCGATCTTGCATCTTGCGAGCACACGGGATTCCAGATCGATCGAGCTATAGCTA
GCTAGCTAATTAGTTACCACGTACGAACGAGTACTTTACAACTCGATCAGTTCATCAAAT
TAACTCGATCAGTGGTTAAGTTTCGCACGACACACGCGCGCGGATCGGAAGCCATCATGC
AGATGCAGGTGCTCACCGCTGCTTCTTCGCTCCCTCGCGCGACCTTGCTCCGGCCGGCGG
CTGCCGAGCCATGGCGCCAATCTTTCCTGCAGCTGCAGGCTCGTCCAATCCAGCGACCAG
GTATCATGCTACACTGCAAGGCCCAGCTACAGGGGCAGGAAACGCGCGAGCGTCGTCAGC
TCGACGACGATGAACACGCTAGACCACCACAGGGCGGCGACGACGACGTCGCAGCAAGCA
CCAGCGAGCTACCCTACATGATCGAGTCCATCAAATCCAAGCTGAGGGCGGCCAGGAACA
GCCTCGGCGAGACCACCGTCTCCGCCTACGACACGGCGTGGATCGCGCTCGTCAACCGCC
TCGACGGCGGCGGCGAGAGGAGCCCCCAGTTCCCGGAGGCCATCGACTGGATCGCCCGGA
ACCAGCTGCCCGACGGCTCGTGGGGCGACGCCGGCATGTTCATCGTCCAGGACCGGCTCA
TCAACACGCTGGGCTGCGTCGTGGCGCTCGCGACGTGGGGCGTCCACGAGGAGCAGCGCG
CGAGGGGCCTCGCCTACATCCAGGACAACCTCTGGAGGCTCGGCGAGGACGACGAGGAGT
GGATGATGGTCGGGTTCGAGATCACCTTCCCCGTTCTCCTCGAGAAGGCCAAGAACCTGG
GCCTGGACATCAACTATGATGACCCTGCCTTGCAGGACATATATGCCAAGAGACAATTAA
AGCTCGCAAAGATTCCTAGAGAAGCACTGCATGCTAGGCCGACCACCTTGCTCCATAGCT
TAGAGGGAATGGAAAACTTGGACTGGGAAAGGTTGCTACAGTTCAAGTGTCCAGCTGGCT
CCTTACATTCCTCACCTGCTGCGTCAGCTTACGCTCTCAGCGAAACAGGTGACAAGGAGT
TGCTCGAATACCTGGAAACAGCCATCAACAATTTTGACGGTGGAGCACCATGCACCTACC
CTGTCGACAACTTTGACCGCTTATGGTCGGTCGATCGGTTGAGGCGGCTAGGAATATCGA
GGTACTTCACGAGTGAGATTGAAGAATACTTGGAGTACGCCTACAGGCACCTGAGTCCAG
ATGGCATGAGCTACGGCGGGCTCTGTCCGGTCAAGGACATCGACGACACGGCCATGGCTT
TCCGTCTCCTCCGTCTGCATGGCTACAATGTCTCATCATCGGTGTTCAATCACTTCGAGA
AGGACGGGGAGTACTTCTGCTTCGCGGGGCAGTCGAGCCAGTCGCTGACGGCGATGTACA
ACTCCTACCGCGCCTCGCAGATCGTCTTCCCCGGCGACGACGACGGCCTGGAGCAGCTCA
GGGCCTACTGCCGCGCCTTCCTCGAGGAGCGGCGAGCCACCGGCAACCTCATGGACAAGT
GGGTCATCGCCAATGGCTTGCCCAGCGAGGTCGAGTACGCGCTGGATTTCCCATGGAAGG
CAAGCTTGCCGCGAGTCGAGACGAGGGTGTATCTGGAGCAGTACGGCGCTAGCGAGGACG
CGTGGATCGGCAAGGGACTCTACAGGATGACCCTAGTCAACAACGACCTGTACCTTGAGG
CGGCAAAGGCTGACTTCACCAACTTCCAGAGGCTCTCCCGGCTCGAGTGGCTCAGCCTGA
AAAGGTGGTACATCAGGAACAATCTGCAAGCGCACGGCGTGACCGAACAGAGCGTGCTGA
GAGCCTACTTCTTAGCCGCGGCGAACATCTTCGAGCCCAACCGGGCGGCGGAACGCCTGG
GATGGGCTCGCACGGCGATCCTCGCCGAGGCCATCGCGTCACACCTCCGACAGTACAGTG
CCAACGGCGCCGCCGACGGCATGACAGAGAGGCTCATCAGTGGACTCGCCAGCCACGACT
GGGACTGGAGGGAATCAAAGGATTCAGCAGCGAGGAGCTTACTGTACGCACTTGATGAGC
TCATCGACCTCCATGCGTTCGGCAATGCTTCTGACAGCCTACGTGAAGCGTGGAAGCAGT
GGCTCATGTCATGGACAAACGAGAGCCAAGGATCAACTGGTGGGGATACCGCATTGCTGC
TAGTTCGCACAATCGAGATCTGCTCAGGACGGCACGGTTCAGCCGAGCAGAGCCTGAAGA
ACAGTGCAGACTACGCCAGGCTTGAGCAGATCGCCTCTTCCATGTGCAGCAAACTTGCCA
CCAAAATTCTTGCTCAGAATGGAGGAAGCATGGACAACGTTGAGGGTATAGACCAGGAAG
TGGATGTTGAGATGAAAGAGCTGATCCAGCGTGTCTACGGGAGCAGCAGCAACGATGTCA
GCAGCGTGACGAGGCAGACATTTCTCGACGTGGTGAAGAGCTTTTGCTACGTCGCTCATT
GCTCGCCCGAAACAATCGATGGGCACATCTCCAAGGTTTTGTTCGAGGATGTCAATTAGG
AAAATGGTTGACTACTAGAAAGGCAATAAAAACAAGAGTTGTGTCTACCAGCATGGCTCG
TAAAGTGATGACTGCGAAAATTTTCTCAAAGTGAGATGAATTTAGTCGATATTTGTTTCA
CTTGATGGTACA

CDS

2403 bp

>Os02t0571100-01 Ent-copalyl diphosphate synthase, Defense against both fungal pathogen and bacterial pathogen, Biosynthesis of phytoalexin
ATGCAGATGCAGGTGCTCACCGCTGCTTCTTCGCTCCCTCGCGCGACCTTGCTCCGGCCG
GCGGCTGCCGAGCCATGGCGCCAATCTTTCCTGCAGCTGCAGGCTCGTCCAATCCAGCGA
CCAGGTATCATGCTACACTGCAAGGCCCAGCTACAGGGGCAGGAAACGCGCGAGCGTCGT
CAGCTCGACGACGATGAACACGCTAGACCACCACAGGGCGGCGACGACGACGTCGCAGCA
AGCACCAGCGAGCTACCCTACATGATCGAGTCCATCAAATCCAAGCTGAGGGCGGCCAGG
AACAGCCTCGGCGAGACCACCGTCTCCGCCTACGACACGGCGTGGATCGCGCTCGTCAAC
CGCCTCGACGGCGGCGGCGAGAGGAGCCCCCAGTTCCCGGAGGCCATCGACTGGATCGCC
CGGAACCAGCTGCCCGACGGCTCGTGGGGCGACGCCGGCATGTTCATCGTCCAGGACCGG
CTCATCAACACGCTGGGCTGCGTCGTGGCGCTCGCGACGTGGGGCGTCCACGAGGAGCAG
CGCGCGAGGGGCCTCGCCTACATCCAGGACAACCTCTGGAGGCTCGGCGAGGACGACGAG
GAGTGGATGATGGTCGGGTTCGAGATCACCTTCCCCGTTCTCCTCGAGAAGGCCAAGAAC
CTGGGCCTGGACATCAACTATGATGACCCTGCCTTGCAGGACATATATGCCAAGAGACAA
TTAAAGCTCGCAAAGATTCCTAGAGAAGCACTGCATGCTAGGCCGACCACCTTGCTCCAT
AGCTTAGAGGGAATGGAAAACTTGGACTGGGAAAGGTTGCTACAGTTCAAGTGTCCAGCT
GGCTCCTTACATTCCTCACCTGCTGCGTCAGCTTACGCTCTCAGCGAAACAGGTGACAAG
GAGTTGCTCGAATACCTGGAAACAGCCATCAACAATTTTGACGGTGGAGCACCATGCACC
TACCCTGTCGACAACTTTGACCGCTTATGGTCGGTCGATCGGTTGAGGCGGCTAGGAATA
TCGAGGTACTTCACGAGTGAGATTGAAGAATACTTGGAGTACGCCTACAGGCACCTGAGT
CCAGATGGCATGAGCTACGGCGGGCTCTGTCCGGTCAAGGACATCGACGACACGGCCATG
GCTTTCCGTCTCCTCCGTCTGCATGGCTACAATGTCTCATCATCGGTGTTCAATCACTTC
GAGAAGGACGGGGAGTACTTCTGCTTCGCGGGGCAGTCGAGCCAGTCGCTGACGGCGATG
TACAACTCCTACCGCGCCTCGCAGATCGTCTTCCCCGGCGACGACGACGGCCTGGAGCAG
CTCAGGGCCTACTGCCGCGCCTTCCTCGAGGAGCGGCGAGCCACCGGCAACCTCATGGAC
AAGTGGGTCATCGCCAATGGCTTGCCCAGCGAGGTCGAGTACGCGCTGGATTTCCCATGG
AAGGCAAGCTTGCCGCGAGTCGAGACGAGGGTGTATCTGGAGCAGTACGGCGCTAGCGAG
GACGCGTGGATCGGCAAGGGACTCTACAGGATGACCCTAGTCAACAACGACCTGTACCTT
GAGGCGGCAAAGGCTGACTTCACCAACTTCCAGAGGCTCTCCCGGCTCGAGTGGCTCAGC
CTGAAAAGGTGGTACATCAGGAACAATCTGCAAGCGCACGGCGTGACCGAACAGAGCGTG
CTGAGAGCCTACTTCTTAGCCGCGGCGAACATCTTCGAGCCCAACCGGGCGGCGGAACGC
CTGGGATGGGCTCGCACGGCGATCCTCGCCGAGGCCATCGCGTCACACCTCCGACAGTAC
AGTGCCAACGGCGCCGCCGACGGCATGACAGAGAGGCTCATCAGTGGACTCGCCAGCCAC
GACTGGGACTGGAGGGAATCAAAGGATTCAGCAGCGAGGAGCTTACTGTACGCACTTGAT
GAGCTCATCGACCTCCATGCGTTCGGCAATGCTTCTGACAGCCTACGTGAAGCGTGGAAG
CAGTGGCTCATGTCATGGACAAACGAGAGCCAAGGATCAACTGGTGGGGATACCGCATTG
CTGCTAGTTCGCACAATCGAGATCTGCTCAGGACGGCACGGTTCAGCCGAGCAGAGCCTG
AAGAACAGTGCAGACTACGCCAGGCTTGAGCAGATCGCCTCTTCCATGTGCAGCAAACTT
GCCACCAAAATTCTTGCTCAGAATGGAGGAAGCATGGACAACGTTGAGGGTATAGACCAG
GAAGTGGATGTTGAGATGAAAGAGCTGATCCAGCGTGTCTACGGGAGCAGCAGCAACGAT
GTCAGCAGCGTGACGAGGCAGACATTTCTCGACGTGGTGAAGAGCTTTTGCTACGTCGCT
CATTGCTCGCCCGAAACAATCGATGGGCACATCTCCAAGGTTTTGTTCGAGGATGTCAAT
TAG

Protein

801 aa

>Os02t0571100-01 Ent-copalyl diphosphate synthase, Defense against both fungal pathogen and bacterial pathogen, Biosynthesis of phytoalexin
MQMQVLTAASSLPRATLLRPAAAEPWRQSFLQLQARPIQRPGIMLHCKAQLQGQETRERR
QLDDDEHARPPQGGDDDVAASTSELPYMIESIKSKLRAARNSLGETTVSAYDTAWIALVN
RLDGGGERSPQFPEAIDWIARNQLPDGSWGDAGMFIVQDRLINTLGCVVALATWGVHEEQ
RARGLAYIQDNLWRLGEDDEEWMMVGFEITFPVLLEKAKNLGLDINYDDPALQDIYAKRQ
LKLAKIPREALHARPTTLLHSLEGMENLDWERLLQFKCPAGSLHSSPAASAYALSETGDK
ELLEYLETAINNFDGGAPCTYPVDNFDRLWSVDRLRRLGISRYFTSEIEEYLEYAYRHLS
PDGMSYGGLCPVKDIDDTAMAFRLLRLHGYNVSSSVFNHFEKDGEYFCFAGQSSQSLTAM
YNSYRASQIVFPGDDDGLEQLRAYCRAFLEERRATGNLMDKWVIANGLPSEVEYALDFPW
KASLPRVETRVYLEQYGASEDAWIGKGLYRMTLVNNDLYLEAAKADFTNFQRLSRLEWLS
LKRWYIRNNLQAHGVTEQSVLRAYFLAAANIFEPNRAAERLGWARTAILAEAIASHLRQY
SANGAADGMTERLISGLASHDWDWRESKDSAARSLLYALDELIDLHAFGNASDSLREAWK
QWLMSWTNESQGSTGGDTALLLVRTIEICSGRHGSAEQSLKNSADYARLEQIASSMCSKL
ATKILAQNGGSMDNVEGIDQEVDVEMKELIQRVYGSSSNDVSSVTRQTFLDVVKSFCYVA
HCSPETIDGHISKVLFEDVN*

5'UTR

chr02:21841092..21841267 (+ strand) : 176 bp

CDS

chr02:21841268..21841391 (+ strand) : 124 bp

chr02:21842042..21842651 (+ strand) : 610 bp

chr02:21843164..21843378 (+ strand) : 215 bp

chr02:21843679..21843799 (+ strand) : 121 bp

chr02:21844267..21844379 (+ strand) : 113 bp

chr02:21844484..21844713 (+ strand) : 230 bp

chr02:21845035..21845150 (+ strand) : 116 bp

chr02:21845282..21845380 (+ strand) : 99 bp

chr02:21846001..21846246 (+ strand) : 246 bp

chr02:21846698..21846797 (+ strand) : 100 bp

chr02:21846887..21847093 (+ strand) : 207 bp

chr02:21847191..21847412 (+ strand) : 222 bp

3'UTR

chr02:21847413..21847545 (+ strand) : 133 bp

FASTA

>Os02t0571100-01 class=Sequence position=chr02:21841092..21847545 (+ strand)
CGGTGATCGA TCTTGCATCT TGCGAGCACA CGGGATTCCA GATCGATCGA GCTATAGCTA GCTAGCTAAT TAGTTACCAC
GTACGAACGA GTACTTTACA ACTCGATCAG TTCATCAAAT TAACTCGATC AGTGGTTAAG TTTCGCACGA CACACGCGCG
CGGATCGGAA GCCATCATGC AGATGCAGGT GCTCACCGCT GCTTCTTCGC TCCCTCGCGC GACCTTGCTC CGGCCGGCGG
CTGCCGAGCC ATGGCGCCAA TCTTTCCTGC AGCTGCAGGC TCGTCCAATC CAGCGACCAG GTAATAATTA Atactccctc
cgtattttaa tgtatgacgc cgttgtcttt ttgaccaacg tttgacaatt cgttttattc aaaatttcca tataaatatg
aaagtattta tatcatgctt aaagaacatt taatgatgaa tcgagtcata ataaaataaa ataaatgata attgtataaa
tttttaaata agacgaatgg tcaaacgttg aataaaaagt taacaacgtt atacattaaa aaaatATGGA GGTAGTAAGT
ATCAACTATT CATCATGCTG CGCGTGCATT CGATCATATC CTGATCGATC GATGACCTCA ACGAACGGGG CGTGCATACA
TGCATGCTTA CCTGTGAACT GTTCTACTGC ACACGTTCAT CGCACGATTC ATAAATCTAT CGATGGAGGT CCTGTTTCGG
GTGTTTCTGA TAACTACAGC TCCTTCCAGA ATCTCAGCTA GCTCTCTTGA ATAATTTATT TTTACAGTAG ATTCTAAGAA
TTTGTAGCTA TAAAGTAAAA TCTAAAATTG TAAACCATAT ATCAGAAGCT GAAAAATCCG GTCCTTTTAA ATTATTTTCG
GTTGGCTACT GGTCAGCTAC CTCTCAGAAG GCAAAACATA GTCTAATATC CATGCCTAAT TATCTTTCAG GTATCATGCT
ACACTGCAAG GCCCAGCTAC AGGGGCAGGA AACGCGCGAG CGTCGTCAGC TCGACGACGA TGAACACGCT AGACCACCAC
AGGGCGGCGA CGACGACGTC GCAGCAAGCA CCAGCGAGCT ACCCTACATG ATCGAGTCCA TCAAATCCAA GCTGAGGGCG
GCCAGGAACA GCCTCGGCGA GACCACCGTC TCCGCCTACG ACACGGCGTG GATCGCGCTC GTCAACCGCC TCGACGGCGG
CGGCGAGAGG AGCCCCCAGT TCCCGGAGGC CATCGACTGG ATCGCCCGGA ACCAGCTGCC CGACGGCTCG TGGGGCGACG
CCGGCATGTT CATCGTCCAG GACCGGCTCA TCAACACGCT GGGCTGCGTC GTGGCGCTCG CGACGTGGGG CGTCCACGAG
GAGCAGCGCG CGAGGGGCCT CGCCTACATC CAGGACAACC TCTGGAGGCT CGGCGAGGAC GACGAGGAGT GGATGATGGT
CGGGTTCGAG ATCACCTTCC CCGTTCTCCT CGAGAAGGCC AAGAACCTGG GCCTGGACAT CAACTATGAT GACCCTGCCT
TGCAGGACAT ATATGCCAAG AGACAATTAA AGCTCGCAAA GTACGTGTTA CAtacttcct ctggctttta ataaatgatt
ttattatctt atatatacac acacatatat atttgatcac tcgtcttaat aaaaagttta cgtaattatt atttattttt
attgtgactt tatggttcca taaagatcct tcaaacatta cttacatgtc aaaaagagaa aaaaaagcat tacttacatt
tcctctatat atatttacct aaaattctta aataagatga atagttaaaT GAAAGTTTCT TAAATATACT AACGAAATTG
AAAAGGgaaa atttacaatt cttaagaggt atcaagagat attaaaaaat ttaatgtaaa tttggtatct tctaatactg
gagatactaa ttaagagcta caaaatattt tacactagaa aatatagtac tatctccctt agtatcactt tctcaaAAAA
TGAAAATATT TAATGATCTA TATGTCTGGA ACCATTAGTT AACCAGCTGT GACACTTCGA AATTAATTGC AGGATTCCTA
GAGAAGCACT GCATGCTAGG CCGACCACCT TGCTCCATAG CTTAGAGGGA ATGGAAAACT TGGACTGGGA AAGGTTGCTA
CAGTTCAAGT GTCCAGCTGG CTCCTTACAT TCCTCACCTG CTGCGTCAGC TTACGCTCTC AGCGAAACAG GTGACAAGGA
GTTGCTCGAA TACCTGGAAA CAGCCATCAA CAATTTTGAC GGTGGAGGTA TAAAAATCAT GACTAGTACT AAATTTTCAG
CTAGTCAACC AAAACCAGGA AGTGACGAGA AAAACAGATT TTATTAGGGT GGAATTTTAC CGTTCAGGTT TATTTTATTC
TTCAATTTAA TTTGTTGAGA AATTTTACGG TTTTTGAGAG ATACCAAGAG GTACCAAAAC TTTTAAACTA CATTTTTGTA
TGTTTTAGTA GTGGATGTAC CGAGAGCTAG CTAGATACTC CTAAATTTCA CAATTGAAAA TGTTCCTCTT TAAAACCGTA
AAATCACTGT AATTTGTTTC ATTTCAGCAC CATGCACCTA CCCTGTCGAC AACTTTGACC GCTTATGGTC GGTCGATCGG
TTGAGGCGGC TAGGAATATC GAGGTACTTC ACGAGTGAGA TTGAAGAATA CTTGGAGTAC GCCTACAGGT AATTAATTTA
CAAACAGCTC GTTCAGAAAC GAAGTGTTGC ATGTATGCAC ATTAATTTTT Aggccttgtt tagttcctat tttttttccc
aaaaacatca catcgaatct ttgaatatat gtatgaagca ttaaatatag ataaagtgaa aaactaactg cacagtttgg
aaatcgcgag acgaatcttt tgtgcctaat tagtctatga ttagccataa gtgctacatg caacccacat acgctaataa
tggattaatt aggcttaata aattcgtctc gtggtgtttt caggtgagtt atgaaattag ttttttcatt cgtgtctgaa
aactccttcc gatatccaat caaatctccg atgtgacacc taaaaattat cttttcacga actaaaccag accTTACCGG
GTTTGAGACG AAGTGTGACT AACTACATAT ACGCGTGCAC ATTTGAAACT AAAAGGCACC TGAGTCCAGA TGGCATGAGC
TACGGCGGGC TCTGTCCGGT CAAGGACATC GACGACACGG CCATGGCTTT CCGTCTCCTC CGTCTGCATG GCTACAATGT
CTCATCATGT AAAAAAACAA AAACTCACAT TTTCTTCCAA AAGCCAATGC ATGCTGCTTT GATGAGTACT TAATTACTCT
GTGGATGTCT GTGTTTTTCT CAATATTTGT AGCGGTGTTC AATCACTTCG AGAAGGACGG GGAGTACTTC TGCTTCGCGG
GGCAGTCGAG CCAGTCGCTG ACGGCGATGT ACAACTCCTA CCGCGCCTCG CAGATCGTCT TCCCCGGCGA CGACGACGGC
CTGGAGCAGC TCAGGGCCTA CTGCCGCGCC TTCCTCGAGG AGCGGCGAGC CACCGGCAAC CTCATGGACA AGTGGGTCAT
CGCCAATGGC TTGCCCAGCG AGGTACGTAC TGTTGCAAAA TTGATAAATA TATGGTTAAT TGTATTTAAT TTGTTACTAC
TAAATATTAG TAATGCATAG GGAAATTTGG CACAGCATAT TTGTTCCATC CTACTGAAAT TTGACAATTC TACCAAATCT
ACCGAAAATT TGGTATTGCT AAATTTTTTT GAACAGAAAT ATTGTCAAAT TTTGGTGAAC ATGCCCATAT ATAGCAATCT
ATTTTCGTAG TAGTAATCAC AAAGCTCGAT CTAGTACAGT TAAGTTGACA ATAATCTATT ATTATTACTT CGATTGCTGA
AATGAAAATG GGGGCATATA TAGGTCGAGT ACGCGCTGGA TTTCCCATGG AAGGCAAGCT TGCCGCGAGT CGAGACGAGG
GTGTATCTGG AGCAGTACGG CGCTAGCGAG GACGCGTGGA TCGGCAAGGG ACTCTACAGG TGACGAGCTC TTCGATCTAA
TTAACCTAGG ACTACACGCA AAATTAAAAA AAAAATTAGT ACCTGAAGGC TAAAGCCGCA TCACGTACGT TTTTGTCATC
TTTGTTGTGT TTTTCTTCGC ATACTTTCAG GATGACCCTA GTCAACAACG ACCTGTACCT TGAGGCGGCA AAGGCTGACT
TCACCAACTT CCAGAGGCTC TCCCGGCTCG AGTGGCTCAG CCTGAAAAGG TCACCACACG TTCCTCTTAA CTATCAATAT
CACAACAACT TAATTTATTC CCTAATCAAC TAACAGTCTG ATACGACGAA CCTACGATGT TTTTATGTAT AACGCGGTTG
ACAAAATAGT AGTAGTAATT Aattaatata ttatgtgtca cttcacaaac atataaactt acattcaaca tatacaatta
gtaacaaaat tgacaaatta gacaacgaat tgtgtgctct actaaagtca atttcatctt tcttttattt tcctatttat
gtaatttgaa attACTACAT CTGTCTTAAA ATGTTGTAAT CTATAATGGG ATTTGACTCA CAATTTTACT ACATATATAG
GATGAGATTT GATCCATCCA AATCTCATCC TAGATTGTAA CATTTTGAGA TGGAGGAAGT ACATCTATGT GCATGTATGT
GCAGTGATAA ATATTCGTTT TGCTAAAACT TTTAAATTTT TATTATATCT TTTTTGGATG ACATGAAAAA CAAGGAGATG
TTCACTCGAG AGAGGGACGA ATAGACTTTC CGTCTGATAT GATATTACTC TACTGTGTAA CTAAAGATGT TTCTTACTCA
CAAGCGTGCG TATGCATCAT GCTGCGCAGG TGGTACATCA GGAACAATCT GCAAGCGCAC GGCGTGACCG AACAGAGCGT
GCTGAGAGCC TACTTCTTAG CCGCGGCGAA CATCTTCGAG CCCAACCGGG CGGCGGAACG CCTGGGATGG GCTCGCACGG
CGATCCTCGC CGAGGCCATC GCGTCACACC TCCGACAGTA CAGTGCCAAC GGCGCCGCCG ACGGCATGAC AGAGAGGCTC
ATCAGTGGAC TCGCCAGCCA CGACTGGGAC TGGAGGTTTA CTCTTCGGCC GCTCATATAT ACTTTTTTAA TTTCTTCAAT
GGATTTCTTC CTTCAAAAAG AAAAGAACAT AATTAATTAT TCTTATAATC AAATTACATT GTTGgagcaa gtttaataat
aataataata gccaactatt agctgcaaaa attaaaacat catttataac caacctaata gtccacttat aaaatattta
gttatagata tatatattgc atcattaata tctaatccac tcatctttca cacatagttt ttatttgaac ctgtgttgca
gctagctata aattaattaa tttgtagctt atttttcttc tctcttcttt tccctcctca acatAAGAAC AAATGTGAGG
TGGTAGCTTG TACAACCCGA TTATATCATC TTATTGTGCT CGCCTATACA GTGATTCATG TAAGATTTTC GTTTGCGTGT
GTGCAGGGAA TCAAAGGATT CAGCAGCGAG GAGCTTACTG TACGCACTTG ATGAGCTCAT CGACCTCCAT GCGTTCGGCA
ATGCTTCTGA CAGCCTACGT GAAGCGGTAA AATTAACTTT AAACTGATGA CATGGTGTGT TAATTAATTT ACCCTGAAAA
TTTTAACACA GTTCAATGTG TTCTGTTAAC TGCAGTGGAA GCAGTGGCTC ATGTCATGGA CAAACGAGAG CCAAGGATCA
ACTGGTGGGG ATACCGCATT GCTGCTAGTT CGCACAATCG AGATCTGCTC AGGACGGCAC GGTTCAGCCG AGCAGAGCCT
GAAGAACAGT GCAGACTACG CCAGGCTTGA GCAGATCGCC TCTTCCATGT GCAGCAAACT TGCCACCAAA ATTCTTGCTC
AGGTACGTGC ATTGATCACT CATCATCACG AATTACAAAA ATTAATTAAA ATGCTGCTTG AGGTTTTTTT TTTAAAAAAC
ATGAATTATG ATCAAACAGA ATGGAGGAAG CATGGACAAC GTTGAGGGTA TAGACCAGGA AGTGGATGTT GAGATGAAAG
AGCTGATCCA GCGTGTCTAC GGGAGCAGCA GCAACGATGT CAGCAGCGTG ACGAGGCAGA CATTTCTCGA CGTGGTGAAG
AGCTTTTGCT ACGTCGCTCA TTGCTCGCCC GAAACAATCG ATGGGCACAT CTCCAAGGTT TTGTTCGAGG ATGTCAATTA
GGAAAATGGT TGACTACTAG AAAGGCAATA AAAACAAGAG TTGTGTCTAC CAGCATGGCT CGTAAAGTGA TGACTGCGAA
AATTTTCTCA AAGTGAGATG AATTTAGTCG ATATTTGTTT CACTTGATGG TACA

Locus: Os02g0571100

Loading...

Locus: Os02g0571100

Loading...