Os02t0575500-02

Locus

Os02g0575500

Description

Similar to ATATH13.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsABC1-2, OsAbc1-2

Oryzabase Gene Name Synonym(s)

ABC1 domain-containing gene 2

Transcript Evidence

AK058407 (DDBJ, Best hit)

Protein Evidence

D2XP29 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

ABC-1 (IPR004147)

Protein kinase-like domain (IPR011009)

Full-length cDNA

001-015-B12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0575500-02)

RiceXPro (AK058407)

Others

Oryzabase (11453)

KEGG (Os02t0575500-02)

Transcript

1421 bp

>Os02t0575500-02 Similar to ATATH13.
tcaggaaatagactatacaaaggaagcatttaatgctgaaaaattttctgaaaacttcaa
aaatatggATTATGTGAAGGTTCCAGAGATTTTGTGGGAGTATACTACACCTCAGGTCTT
AACAATGGAATACGTCCCAGGAATCAAGATAAATAGGATAAAGCAGCTAGATAAGTTAGG
AGTTGATCGGAAAAGGTTAGGTCGGTATGCTGTTGAGTCGTACCTGGAGCAGATCTTATC
TCATGGATTTTTCCATGCAGATCCGCATCCAGGAAATATTGCTGTTGATGATGTCAACGG
TGGGAGGCTTATCTTCTACGACTTTGGAATGATGGGAAGCATTAGTCCAAATATCCGGGA
AGGGTTGCTCGAAGCATTCTATGGAGTTTATGAAAAAGATCCTGATAAAGTGCTTCAATC
AATGATTCAAATGGGTGTCCTTGTTCCTACTGGAGATATGACGGCTGTCAGAAGAACAGC
TCAATTTTTCCTTGATAGCTTCGAAGAGCGTTTAGCAGCACAAAGGAAAGAAAGAGAGAT
GGCGACTGAGGAACTTGGATTTAAGAAGCAATTAACTAAGGAGGAGAAGTTTGAAAAGAA
GAAGCAAAGGCTTGCTGCTATCGGAGAGGATCTTTTGTCAATTGCTGCTGATCAACCATT
TCGATTTCCTGCCACCTTTACTTTTGTGGTCAGAGCATTCTCAGTACTAGATGGTATCGG
GAAGGGCCTTGATCCTAGATTTGATATCACAGAGATTGCTAAACCATATGCTATGGAGTT
GCTTAGATTTAATGAAGCTGGAGTTGAAGTTATTGTAAAGGATGCGAGGAAGAGATGGGA
AAGGCAGTCCCGTGCATTCTACAATTTATTTCGCCAGCCCGACAGAGTTGAAAAGCTTGC
GCAAATCATTGAGCGTTTGGAGCAAGGTGATCTCAAGCTTCGTGTCAGAACATTGGAGTC
AGAAAGAGCATTCCAAAGAGTTGCAGCTGTACAGAAAACAATTGGATATGGAGTTGCCGC
AGGTAGTTTGGTAAACCTCGCCACCGTTCTCTACCTCAATTCAATCCGGTTGCCAGCGAC
CATAGCATACTCTCTCTGCGCGTTCTTCGGCCTACAAGTCCTTGTCGGCCTTTTGAAGGT
CAAGAAGTTGGATCAACAGGAGAGACTGATAACCGGCACTGCTTGAGTCCGGGCATAAAC
TGGTGAGAGCTGACCCGTGATTTTTTTGGTGTCATCCACAGCGGCTATATATCTTCCCCG
TTTTTTGTTTCTTTCTGTCCAAATTTTAGATCCCCTACACGTTGTAGCATAGCCATCGGT
GTACGATAACTGTATATGTAGATGCGGTGAATAGATGAAAATGTACATAGTGTACAATAG
ACATTCACTGAGGTGTTAAGGTGCTTTTGTGGTTGCAATTC

CDS

1185 bp

>Os02t0575500-02 Similar to ATATH13.
caggaaatagactatacaaaggaagcatttaatgctgaaaaattttctgaaaacttcaaa
aatatggATTATGTGAAGGTTCCAGAGATTTTGTGGGAGTATACTACACCTCAGGTCTTA
ACAATGGAATACGTCCCAGGAATCAAGATAAATAGGATAAAGCAGCTAGATAAGTTAGGA
GTTGATCGGAAAAGGTTAGGTCGGTATGCTGTTGAGTCGTACCTGGAGCAGATCTTATCT
CATGGATTTTTCCATGCAGATCCGCATCCAGGAAATATTGCTGTTGATGATGTCAACGGT
GGGAGGCTTATCTTCTACGACTTTGGAATGATGGGAAGCATTAGTCCAAATATCCGGGAA
GGGTTGCTCGAAGCATTCTATGGAGTTTATGAAAAAGATCCTGATAAAGTGCTTCAATCA
ATGATTCAAATGGGTGTCCTTGTTCCTACTGGAGATATGACGGCTGTCAGAAGAACAGCT
CAATTTTTCCTTGATAGCTTCGAAGAGCGTTTAGCAGCACAAAGGAAAGAAAGAGAGATG
GCGACTGAGGAACTTGGATTTAAGAAGCAATTAACTAAGGAGGAGAAGTTTGAAAAGAAG
AAGCAAAGGCTTGCTGCTATCGGAGAGGATCTTTTGTCAATTGCTGCTGATCAACCATTT
CGATTTCCTGCCACCTTTACTTTTGTGGTCAGAGCATTCTCAGTACTAGATGGTATCGGG
AAGGGCCTTGATCCTAGATTTGATATCACAGAGATTGCTAAACCATATGCTATGGAGTTG
CTTAGATTTAATGAAGCTGGAGTTGAAGTTATTGTAAAGGATGCGAGGAAGAGATGGGAA
AGGCAGTCCCGTGCATTCTACAATTTATTTCGCCAGCCCGACAGAGTTGAAAAGCTTGCG
CAAATCATTGAGCGTTTGGAGCAAGGTGATCTCAAGCTTCGTGTCAGAACATTGGAGTCA
GAAAGAGCATTCCAAAGAGTTGCAGCTGTACAGAAAACAATTGGATATGGAGTTGCCGCA
GGTAGTTTGGTAAACCTCGCCACCGTTCTCTACCTCAATTCAATCCGGTTGCCAGCGACC
ATAGCATACTCTCTCTGCGCGTTCTTCGGCCTACAAGTCCTTGTCGGCCTTTTGAAGGTC
AAGAAGTTGGATCAACAGGAGAGACTGATAACCGGCACTGCTTGA

Protein

395 aa

>Os02t0575500-02 Similar to ATATH13.
QEIDYTKEAFNAEKFSENFKNMDYVKVPEILWEYTTPQVLTMEYVPGIKINRIKQLDKLG
VDRKRLGRYAVESYLEQILSHGFFHADPHPGNIAVDDVNGGRLIFYDFGMMGSISPNIRE
GLLEAFYGVYEKDPDKVLQSMIQMGVLVPTGDMTAVRRTAQFFLDSFEERLAAQRKEREM
ATEELGFKKQLTKEEKFEKKKQRLAAIGEDLLSIAADQPFRFPATFTFVVRAFSVLDGIG
KGLDPRFDITEIAKPYAMELLRFNEAGVEVIVKDARKRWERQSRAFYNLFRQPDRVEKLA
QIIERLEQGDLKLRVRTLESERAFQRVAAVQKTIGYGVAAGSLVNLATVLYLNSIRLPAT
IAYSLCAFFGLQVLVGLLKVKKLDQQERLITGTA*

5'UTR

chr02:22081115..22081115 (+ strand) : 1 bp

CDS

chr02:22081116..22081229 (+ strand) : 114 bp

chr02:22081316..22081395 (+ strand) : 80 bp

chr02:22081487..22081556 (+ strand) : 70 bp

chr02:22082499..22082572 (+ strand) : 74 bp

chr02:22082704..22082773 (+ strand) : 70 bp

chr02:22082857..22082945 (+ strand) : 89 bp

chr02:22083055..22083179 (+ strand) : 125 bp

chr02:22083293..22083373 (+ strand) : 81 bp

chr02:22083455..22083515 (+ strand) : 61 bp

chr02:22083609..22083661 (+ strand) : 53 bp

chr02:22083780..22083880 (+ strand) : 101 bp

chr02:22083998..22084087 (+ strand) : 90 bp

chr02:22084524..22084583 (+ strand) : 60 bp

chr02:22084679..22084795 (+ strand) : 117 bp

3'UTR

chr02:22084796..22085030 (+ strand) : 235 bp

FASTA

>Os02t0575500-02 class=Sequence position=chr02:22081115..22085030 (+ strand)
tcaggaaata gactatacaa aggaagcatt taatgctgaa aaattttctg aaaacttcaa aaatatggAT TATGTGAAGG
TTCCAGAGAT TTTGTGGGAG TATACTACAC CTCAGGTTCC TACTATCCAG AGACTTGTAA AATAGAATAT CGAGTAGCAT
AGAATAGAAT ATAACACTAT ATATTTCTGT CCTCTATGCA GGTCTTAACA ATGGAATACG TCCCAGGAAT CAAGATAAAT
AGGATAAAGC AGCTAGATAA GTTAGGAGTT GATCGGAAAA GGTATGTGTG CTGTATGCTG GTGAGCCATA GCTTCAGTTT
GCTTTACCAA TTGACATTGG TTGCTTATTA TCCCTCCTTG AACCCCTCTC AGGTTAGGTC GGTATGCTGT TGAGTCGTAC
CTGGAGCAGA TCTTATCTCA TGGATTTTTC CATGCAGATC CGGTCAGTTG TACTGTATAT TTTTCAAAAG CAATGCTGTA
GTTGTTTGTC CTGTTATGGT TATTTCTTAC TTTTACATTA TTCTATTCTT GCACTAGACT GTGCAAATGA ATCATGAAGA
TGATTCTGCA CTGAGAGAAG CTATATCATC TTTTGACGTA GGGAGAAACt actctctccg gtcgtaaata tttggcgttt
aagacaagat ctggtcaaac tcaaattttc gagtagcaat attttattcg atgtttagtt ttaaaaaata gaaatggtaa
tacatagact taccttgaag agtactatat aatatgatta agttgttgga ttttataaac tcatgctaat acgaaattga
tggtcggaat tttaaaagtt tgaccaaata gtcctaaacg tcaaatattt atgaatAGAG TTAGTTCGGT GTATATCATT
GTAGTTCTGA GATCTATCCC TGCTACTGGG CCTTTTGCAA GGTGGTATAT GCTTAATTTG TTAAAAGTTG TGTAACCCTG
TAAGTCTGTA ACCTCAGCTG TACATGCTTC AGCTACATGC GCATGAACTA TAGGCTtaga gatttgttcc ggtccaataa
aaagtacctc gaggtaccgg tacctcacag tactaaatcg tttacaatcg ttggatctaa caattcccat cctgcccagc
tagatccaac tatcggaaac aattcggtac cgtgaggtac cggtatctcg aggtactttt tgttggaccg gagcaaatct
cATAGGCTTA ATGAGCAATA TGCTATTGCC TCCGGCATTA CAAATTTCAT GGCACATAAT CATTCTTTTG TCCTTTTCCT
CCTTTTTAAT TTCTCAATTC AATGCAGCTG TGATGCTCCT TTTAAGAAGC TACCTTTTTA AAAATAAACA ACTTTTAAAA
AATCTAATAT AGATTTCTTT ACAGCATCCA GGAAATATTG CTGTTGATGA TGTCAACGGT GGGAGGCTTA TCTTCTACGA
CTTTGGAATG ATGGGAAGGT TACATCTGAT ATCTTTGTTT GTTTCCATAA ACTTCCATTC AGTTAAAAGT TGTGCAATAG
TATGTTTTTC CTTGAGTAGT TACAGGGTTG CAGAACGTTT AATCTGACCT TCACTCTTCT TACTTTCAGC ATTAGTCCAA
ATATCCGGGA AGGGTTGCTC GAAGCATTCT ATGGAGTTTA TGAAAAAGAT CCTGATAAAG TATGTTTGTC TGGGCATGAC
CTTCAAAAGT ATAACTTAAA TACCTTAAGT TCTGCAAAAC ATCCAATAAT AAATTCCTGC AGGTGCTTCA ATCAATGATT
CAAATGGGTG TCCTTGTTCC TACTGGAGAT ATGACGGCTG TCAGAAGAAC AGCTCAATTT TTCCTTGATA GGTAATAATT
TTGTTCTGAG AGGATATTCT TCGTAATTAC CTATATACCT CGAGTTTCTT GAGTGAGGTG AACTACTGTA ACACTTGGCT
TCACTTTGTT GTGTGTATAG CTTCGAAGAG CGTTTAGCAG CACAAAGGAA AGAAAGAGAG ATGGCGACTG AGGAACTTGG
ATTTAAGAAG CAATTAACTA AGGAGGAGAA GTTTGAAAAG AAGAAGCAAA GGCTTGCTGC TATCGGTAAT GAGTCAATAG
ATTCTGCAGC CTATTAGAGA ACATGATAAA AGTAAATGTG TCAAGGTGTA TGTATTTCGA CCGGTTGCTT TCTGTTTACT
TGAAACAAAA TTTTGCAGGA GAGGATCTTT TGTCAATTGC TGCTGATCAA CCATTTCGAT TTCCTGCCAC CTTTACTTTT
GTGGTCAGAG CATTCTCAGG TATGATATGC AATAATTTGT GTACAAGAAA CGTGGTTGTG ACATAATGCC ATGGTTCCTC
ATTCTCCATT CTGTGTGCAG TACTAGATGG TATCGGGAAG GGCCTTGATC CTAGATTTGA TATCACAGAG ATTGCTAAAC
CGTGAGTATT TTTCTCCTTC AAGAATTTTG TTTTCTTATT TAAGTTTCAA GTTGCAATTT GGGTTCTGAC TTGATACATC
CAATGAATTG CTAGATATGC TATGGAGTTG CTTAGATTTA ATGAAGCTGG AGTTGAAGTT ATTGTAAAGG CAAGTTTTCA
TCTTTGGTCC ATAGATTTAA TACCTTATTT GATGGCACAT CTTCTAATAT GACTATGCAT GTTCAGACTT GAGAGTTTTA
AGCGCTCTTG GTTTTATTTT ACCTCAGGAT GCGAGGAAGA GATGGGAAAG GCAGTCCCGT GCATTCTACA ATTTATTTCG
CCAGCCCGAC AGAGTTGAAA AGCTTGCGCA AATCATTGAG CGTTTGGTAA AAAACACCTT TTCTCCATTA TTTTCTGCAG
TTTGCTGGTT TTGTTTGTAG AACTGTCGTA GATAATTGCC TCTTTCTTTT TCTTTTTTTC TCTTTTTTTT TTGGCTTTTG
CAGGAGCAAG GTGATCTCAA GCTTCGTGTC AGAACATTGG AGTCAGAAAG AGCATTCCAA AGAGTTGCAG CTGTACAGAA
AACAATTGGA TATGTGAGTT CAGAATTGTT GATGAATGGT TTACTTTTTG TATTTCACTA TGCTAGTACA GGAAAAAAAT
GCAAGGTTTT TCTTGGACCG AGTTAGTTGG AACTGGTGCA GATAATAAAT TTTGTGCCGA AACATCTTTA GAGATTAACC
TAGGGTGCTT CTGTTTAAAG GGGAAAAATG TTTGGTTGGG TAGAACAGCC TTtaaattat gagaaaatcc aagaaatacc
atttacaagt actcacttcc aataaatgAG TGTCAATCCT TGTTACGTTT TTCGTATAAA AAAACTCAAA AAAGTTGTCA
TGAGCTCTGC CTTATCTATT AAGAGGATCC TAGTTTCTTG AATAAAACTG TCTTAAGTGT TTTGAGTAAT GCACATCACC
GTCTTATGGT TTGTTTTGAA ATGGTGAAAT CTGCTTGCGC ATCACGCAGG GAGTTGCCGC AGGTAGTTTG GTAAACCTCG
CCACCGTTCT CTACCTCAAT TCAATCCGGG TAAGTTACCA AGTTTCCAAA CAAGCCATGT TCATCTTTTT CATCAGATTA
CTCTTGCACA GCTGTTTCAC TGCACCTTCA ATCATCCACT GCAGTTGCCA GCGACCATAG CATACTCTCT CTGCGCGTTC
TTCGGCCTAC AAGTCCTTGT CGGCCTTTTG AAGGTCAAGA AGTTGGATCA ACAGGAGAGA CTGATAACCG GCACTGCTTG
AGTCCGGGCA TAAACTGGTG AGAGCTGACC CGTGATTTTT TTGGTGTCAT CCACAGCGGC TATATATCTT CCCCGTTTTT
TGTTTCTTTC TGTCCAAATT TTAGATCCCC TACACGTTGT AGCATAGCCA TCGGTGTACG ATAACTGTAT ATGTAGATGC
GGTGAATAGA TGAAAATGTA CATAGTGTAC AATAGACATT CACTGAGGTG TTAAGGTGCT TTTGTGGTTG CAATTC

Locus: Os02g0575500

Loading...

Locus: Os02g0575500

Loading...