Os02t0575700-01

Locus

Os02g0575700

Description

Similar to OSIGBa0097P08.1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IIP3

CGSNL Gene Name

ILA1 INTERACTING PROTEIN 3

Oryzabase Gene Symbol Synonym(s)

IIP3

Oryzabase Gene Name Synonym(s)

ILA1 interacting protein 3

Transcript Evidence

AK105763 (DDBJ, Best hit)

Protein Evidence

Q01JK4 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-202-D10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0575700-01)

RiceXPro (AK105763)

Others

Oryzabase (10224)

KEGG (Os02t0575700-01)

Transcript

2634 bp

>Os02t0575700-01 Similar to OSIGBa0097P08.1 protein.
TTAATCTTTTGGTTGTTTCTACCTTTGCTCTGATCGATCTATGTCTGCTTCCTGGACTTT
TCAGTCTGGTAAATTTTTTCCATCAGACAGAAATTATCTGGCTACAACCTGCTGCTTCTT
GATGCTCAACTACCAGAGAATTAACATCACTATCTCAGATGGTCTAGCCCGTCAGAGTTG
AAGTACAGTCTGGATCAAAATTTTCCTGAAATCCAGACAGTAAGTTCATGGACAGGGCGG
ACACATCGGGTTTTGTCAGTGGTGGACTCATCGGTACTTCGCTGCTGCTGATTTTCTTCC
ACTTCGTCTACTCTCCAGTGCACATATAGAACAAGATCAAGAAGCACCTGATCTATCTTT
GTCTCGTTGTTTCTTCCACCTTCTGTACATTGCAGGATTACTTAGCCTAGATGAATAACG
GTTTTCCGGAAATCATTCGCCGCGGAAACCCGCATCTGATGGATAATTCCGCAGTTGTGA
TAATGGGACACTCTGTGGCAAGCTACACCATGGACAGCCATGGACGGAGCTCTTCTTGCC
TAGACCACCTGGGTTCATCAATGGAGAACAGTAGTATCCATGGCAAGAGAGGTAACAACC
GGAGGTCGGGTCATGGTGTGTCTGCGCAAGATGACGGCTGCGGGTTGGTTCTTGGATTGG
GTCCATCGCCGGAGATGGGCTCCTCCGCGGCGCGCAGGTCGAAAGCGCCGGCGCCGGCGA
CATTGTTCAGCCAGAGGAGCTTCTCCTTCACTGAGCCAGGGGTGCTCAGCCTTGGGCTTC
ATCGGGGAGATCATGGTGGCGCGACGATTCAGCATCTGGAAGAAGCGCCTGCTGGGAACA
TCATCTCCTTCGCCGCCGCCGTCGATGAGGGCTCGACGTCGGCGAGGAGGAGCTCCGGTG
GGTACATGCCGTCGCTGCTCTTCGCGCCTCGGCCCAACGCGTCGGCTCCTGAAGAGGCTC
GTCATGATGTCGTGGCGGATCACACGGACAACACCGTGAGTGGTGGTGGCGCGCGCCATG
GCCATGCGCGGCGTCGCGTCGTTCGTCAGCTCAGCCCTGAGCCTGAGCCTGAGCCTTCGG
CGACCATGACGGAGACCTCGTTCGGTGTGAGCTCCGACGTGGTCACGACGGTGACCAATC
CTGTGACGACGCAGCCGGCGGCGGCGGCGGCGCAGTCGCAACGCCGGCATCCGAAGAAGT
GCAGGTTCAAGGGGTGCTCCAAAGGAGCGCGAGGCGCGTCGGGGCTGTGCATCGCCCATG
GCGGCGGGCAGAGGTGCCAGAAGCCCGGGTGCCACAAGGGCGCCGAGAGCCGCACGGCCT
ACTGCAAGGCGCATGGCGGTGGCCGCCGGTGCATGCAGCTCGGCTGCACCAAGAGCGCCG
AGGGGAAGACGGATCACTGCATCGCCCACGGCGGCGGCCGCCGGTGCGGGCACCAGGGCT
GCCCGAAGGCCGCGCGGGGGAAGTCCGGGCGGTGCATCAAGCATGGCGGAGGGAAGAGGT
GTTCGGTCGAGGGCTGCATCCGGAGCGCGGAGGGGAGGGTCGGGCTCTGCATCTCCCACG
GCGGCGGGCGGCGGTGCCAGTACCCGGACTGCCGAAAGGGCGCGCAGGGGAGCACGCTGT
ACTGCAAGGCGCACGGCGGCGGCAAGCGGTGCGTGTTCGACGGGTGCCTCAAGGGCGCGG
AGGGGAGCACGCCGCTGTGCAAGGCGCACGGCGGCGGGAAGCGGTGCATGTTCGAGGGCG
GCGGGCTCTGCCCCAAGAGCGTCCACGGCGGCACCAGCTTCTGCGTGGCGCACGGCGGCG
GGAAGCGGTGCACGGTGCCCGGGTGCGGCAAGAGCGCCCGCGGCCGCACGGACTGCTGCG
TCAAGCACGGCGGCGGCAAGCGGTGCAGGGTCGACGGCTGCGCCAAGAGCGCGCAGGGGA
GCACGGAGTTCTGCAAGGCCCACGGCGGCGGCAAGCGCTGCACCTGGGCCACCGGCTGCG
AGAAGTTCGCCCGCGGGCGGAGCGGCCTCTGCGCCGCGCACGGCACGCTCATGGCCTCAC
AGCAGCGTCGCGCCGGCGGCGGCGGGAGCATGATCGGTCCAGGGCTCTTCCACGGCCTCG
TCGGCGCCATGAACAACGGCTACTCGTCCTCCGGCGTCAGCACGGCGTCGGAGTACTCCG
ACGCCTGCGACGGCGCGGCGAGGAGGCAAGAGCTGATACCTCCTCAGGTGCTGGTCCCGA
ACTCCATGAAGTCGTCGTGCTCGTCGGCGCCGCCGCCGTCGATGGGCAGGGGCAGAGAGG
GAGGAGGGTTCGTCGTCCCCGAGGGGAGGGTGCACGGTGGCGGCCTCCTGTCGTTGCTCG
GCGGGAGCTTCAGGAACGTCGACGTCGACGAGCTCTGAAGCAGCAGCGCTCGTGTGAGAA
AATCAGTGTCAGTTTCTGCATCTCAAAAAACGGAGGAAAAAAAACGAAGAGAAAAAAAGA
AAGAGATTCTATAGCTCATATAGATGTTAGGTTGGTACGAAACTTCATAGATTGTTTTGA
TGTTATTATCGTGTCAAGATTCAAGTCTCAGGGCATGAACTTGTCAGGGGATTTCAAATG
TTTTGAGTTCGTTGTGAATAAAATGTAGTAGACATGAACTTGTCAGGGGATTTC

CDS

1968 bp

>Os02t0575700-01 Similar to OSIGBa0097P08.1 protein.
ATGAATAACGGTTTTCCGGAAATCATTCGCCGCGGAAACCCGCATCTGATGGATAATTCC
GCAGTTGTGATAATGGGACACTCTGTGGCAAGCTACACCATGGACAGCCATGGACGGAGC
TCTTCTTGCCTAGACCACCTGGGTTCATCAATGGAGAACAGTAGTATCCATGGCAAGAGA
GGTAACAACCGGAGGTCGGGTCATGGTGTGTCTGCGCAAGATGACGGCTGCGGGTTGGTT
CTTGGATTGGGTCCATCGCCGGAGATGGGCTCCTCCGCGGCGCGCAGGTCGAAAGCGCCG
GCGCCGGCGACATTGTTCAGCCAGAGGAGCTTCTCCTTCACTGAGCCAGGGGTGCTCAGC
CTTGGGCTTCATCGGGGAGATCATGGTGGCGCGACGATTCAGCATCTGGAAGAAGCGCCT
GCTGGGAACATCATCTCCTTCGCCGCCGCCGTCGATGAGGGCTCGACGTCGGCGAGGAGG
AGCTCCGGTGGGTACATGCCGTCGCTGCTCTTCGCGCCTCGGCCCAACGCGTCGGCTCCT
GAAGAGGCTCGTCATGATGTCGTGGCGGATCACACGGACAACACCGTGAGTGGTGGTGGC
GCGCGCCATGGCCATGCGCGGCGTCGCGTCGTTCGTCAGCTCAGCCCTGAGCCTGAGCCT
GAGCCTTCGGCGACCATGACGGAGACCTCGTTCGGTGTGAGCTCCGACGTGGTCACGACG
GTGACCAATCCTGTGACGACGCAGCCGGCGGCGGCGGCGGCGCAGTCGCAACGCCGGCAT
CCGAAGAAGTGCAGGTTCAAGGGGTGCTCCAAAGGAGCGCGAGGCGCGTCGGGGCTGTGC
ATCGCCCATGGCGGCGGGCAGAGGTGCCAGAAGCCCGGGTGCCACAAGGGCGCCGAGAGC
CGCACGGCCTACTGCAAGGCGCATGGCGGTGGCCGCCGGTGCATGCAGCTCGGCTGCACC
AAGAGCGCCGAGGGGAAGACGGATCACTGCATCGCCCACGGCGGCGGCCGCCGGTGCGGG
CACCAGGGCTGCCCGAAGGCCGCGCGGGGGAAGTCCGGGCGGTGCATCAAGCATGGCGGA
GGGAAGAGGTGTTCGGTCGAGGGCTGCATCCGGAGCGCGGAGGGGAGGGTCGGGCTCTGC
ATCTCCCACGGCGGCGGGCGGCGGTGCCAGTACCCGGACTGCCGAAAGGGCGCGCAGGGG
AGCACGCTGTACTGCAAGGCGCACGGCGGCGGCAAGCGGTGCGTGTTCGACGGGTGCCTC
AAGGGCGCGGAGGGGAGCACGCCGCTGTGCAAGGCGCACGGCGGCGGGAAGCGGTGCATG
TTCGAGGGCGGCGGGCTCTGCCCCAAGAGCGTCCACGGCGGCACCAGCTTCTGCGTGGCG
CACGGCGGCGGGAAGCGGTGCACGGTGCCCGGGTGCGGCAAGAGCGCCCGCGGCCGCACG
GACTGCTGCGTCAAGCACGGCGGCGGCAAGCGGTGCAGGGTCGACGGCTGCGCCAAGAGC
GCGCAGGGGAGCACGGAGTTCTGCAAGGCCCACGGCGGCGGCAAGCGCTGCACCTGGGCC
ACCGGCTGCGAGAAGTTCGCCCGCGGGCGGAGCGGCCTCTGCGCCGCGCACGGCACGCTC
ATGGCCTCACAGCAGCGTCGCGCCGGCGGCGGCGGGAGCATGATCGGTCCAGGGCTCTTC
CACGGCCTCGTCGGCGCCATGAACAACGGCTACTCGTCCTCCGGCGTCAGCACGGCGTCG
GAGTACTCCGACGCCTGCGACGGCGCGGCGAGGAGGCAAGAGCTGATACCTCCTCAGGTG
CTGGTCCCGAACTCCATGAAGTCGTCGTGCTCGTCGGCGCCGCCGCCGTCGATGGGCAGG
GGCAGAGAGGGAGGAGGGTTCGTCGTCCCCGAGGGGAGGGTGCACGGTGGCGGCCTCCTG
TCGTTGCTCGGCGGGAGCTTCAGGAACGTCGACGTCGACGAGCTCTGA

Protein

656 aa

>Os02t0575700-01 Similar to OSIGBa0097P08.1 protein.
MNNGFPEIIRRGNPHLMDNSAVVIMGHSVASYTMDSHGRSSSCLDHLGSSMENSSIHGKR
GNNRRSGHGVSAQDDGCGLVLGLGPSPEMGSSAARRSKAPAPATLFSQRSFSFTEPGVLS
LGLHRGDHGGATIQHLEEAPAGNIISFAAAVDEGSTSARRSSGGYMPSLLFAPRPNASAP
EEARHDVVADHTDNTVSGGGARHGHARRRVVRQLSPEPEPEPSATMTETSFGVSSDVVTT
VTNPVTTQPAAAAAQSQRRHPKKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCHKGAES
RTAYCKAHGGGRRCMQLGCTKSAEGKTDHCIAHGGGRRCGHQGCPKAARGKSGRCIKHGG
GKRCSVEGCIRSAEGRVGLCISHGGGRRCQYPDCRKGAQGSTLYCKAHGGGKRCVFDGCL
KGAEGSTPLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVAHGGGKRCTVPGCGKSARGRT
DCCVKHGGGKRCRVDGCAKSAQGSTEFCKAHGGGKRCTWATGCEKFARGRSGLCAAHGTL
MASQQRRAGGGGSMIGPGLFHGLVGAMNNGYSSSGVSTASEYSDACDGAARRQELIPPQV
LVPNSMKSSCSSAPPPSMGRGREGGGFVVPEGRVHGGGLLSLLGGSFRNVDVDEL*

5'UTR

chr02:22096140..22096193 (+ strand) : 54 bp

chr02:22098153..22098508 (+ strand) : 356 bp

CDS

chr02:22098509..22100476 (+ strand) : 1968 bp

3'UTR

chr02:22100477..22100732 (+ strand) : 256 bp

FASTA

>Os02t0575700-01 class=Sequence position=chr02:22096140..22100732 (+ strand)
TTAATCTTTT GGTTGTTTCT ACCTTTGCTC TGATCGATCT ATGTCTGCTT CCTGGTATGT ATGGGTAGTA GAGTCGCAAG
AATATTCGGT TAGGCCTGCA TGTGTGTTAG TTATTTTTTT TAAAAAAATT TCTTCTGCGG GTGAGTTCTT GATTTCCCTG
TAGCGATTCG AGTCTCTCTC TTCAGGTTGA TGTCCATGGA TGGGCTTCGG TTAGGGAATT GTTTGCGCGG TTTTAGTTAG
ATCTGTCGCG TGTGCCCTGC TTTGTTTGTT TGGTTGGTTT GTGGGAATTC ACAAGATTTT TTGTTTGTTT TGCTGGGTTT
CTCGAAGCTT GTGCGGTAGG AAGTGTGAGC GAATTTGCTG ATATTTTCTC TTTAGATTTA GCTTTTCTCT TCAAAACCAG
ATATCGAGGT ACTGTTTACA AATTGTGACA GATATTGGAC AAAGTTGTAG GGAAGCTCAT ATATGTGATT ATTTTCTCTT
CCACCTTGAA GCTTGCTGCA TAAACTGAAA CAGTTTTCCA TATAAAAAAC GGAAGAATTT CGCTTGATTT GTTCCTCATA
GAACACCTTA GCAAACAGCC ACACCCTATA AACGTAGTTA ATTCTTTTAG TCCAGGACAT GAATATACTC TCTTAGTATG
GTACGGATTT GTATCGGAGT TGCTGCGGTT TAGGTAGTTT CAGGTATTTT TCCCACGTAA ATCTGAAATG GTTTTCACAG
CCATGGGTCC TACTAGAATA CCACCAAGCT ATTCAGCTTG TCTCATGCAA GCCAAGGCTC AAGGTGACAC CTATGTTTGT
GGTCAGGGTT GTTTAGTTAG CTGTTCGCTT GGTCATACGT ATGAATCTTG TTTTGAATCC AATAGAACAT CACATGCACA
GGTAGCATCT CATGCTTGTG ATGTTCTCTT TTCGTCGGTT ACCGATCGTC TAGTCAACTG AATCAGAGAT TCCAATTGTC
CTAAAAAAAT ATGTGTATGT TCATGGCTAT TAAGCTGAAT ATGCGGTTTG TACGGTGAAG AAACGATCTG GCATGTTTGC
TCTGTTAGGT ACGACATGAA CATGCTAAAT TAAGCAGTAA TTCTATGAGA AAGTGGCGAT TAATTGCACT GATCCGTTCT
TAGTTATGCA GCATGAGATT TATGTGATTC AGTTCATCTG CTTAATTGTC AACATAGTTA GCATGACGTG CTGGGGTTCT
AATTAGAATT GCTAAAAATT TCAGTCAAGT TGCTAGCCAA CCCATTTTTG TCAAGAAAAA ATGATGGGGG GACTCTGTTG
ATATGTGGAT GTGCGGAAGT TTTGACTTTT ATTATGTACT GGACACGCCT TTATATTTCT TAAATATTTA GAAGGTATAT
GTAATTATGA GTTCAAACTA AAATTTGGTC TAATAAACAT TTCGTGATTA TTTATTAGGT GAGACCTTGG GTTTAGCTTG
AATTCCTGTA TCTGACTAAT TCTGTTTAAC TCCCCTCTTG ATAAATGGAA TAACTAGTTT GCCTACGAAA ACAAAATTTA
AAATTTTATA ACGTGCAAAA TATTAAAATG TATTTCTTGT AAACATTCAC TCTACCGAAA CATTAGTCAT TCTACCGAGA
TAAAATTTCC TTCGATGATA GTTTCGTGGT GTGTTGTAGC TGTTGTGATC AATGAATTAA TGGTCAGGAC TAGCTGACTT
CCTCACTGCA ATTAAGCTTG ATCTTGAACT CCTGTTGGGA AGACAGCAAT TAAAATTTTA GTGGAACCAT GTAATCAGTC
AGAGAAACAG AGATTGTACG AGCACTGTTA CAGAAAATGA AATTAGAAGC ACAAAAAACC TGTAGCTCCT AAAAGTCTTC
AGTTTCAGCA ATTCAAAGTC ATTCCCAAGA CTTGATTGTT TGTTCTTCCT GAAGATCCCT GTGCAAAGAA GTCTAGACTG
TCCTTTTCTA ATTATGCATT TGATGATACT ACCAATCCTA CAGTCGTTTG TGGCATGATC TTGAGCTGAC TTACCATTTC
CATCCTATTG CAGGACTTTT CAGTCTGGTA AATTTTTTCC ATCAGACAGA AATTATCTGG CTACAACCTG CTGCTTCTTG
ATGCTCAACT ACCAGAGAAT TAACATCACT ATCTCAGATG GTCTAGCCCG TCAGAGTTGA AGTACAGTCT GGATCAAAAT
TTTCCTGAAA TCCAGACAGT AAGTTCATGG ACAGGGCGGA CACATCGGGT TTTGTCAGTG GTGGACTCAT CGGTACTTCG
CTGCTGCTGA TTTTCTTCCA CTTCGTCTAC TCTCCAGTGC ACATATAGAA CAAGATCAAG AAGCACCTGA TCTATCTTTG
TCTCGTTGTT TCTTCCACCT TCTGTACATT GCAGGATTAC TTAGCCTAGA TGAATAACGG TTTTCCGGAA ATCATTCGCC
GCGGAAACCC GCATCTGATG GATAATTCCG CAGTTGTGAT AATGGGACAC TCTGTGGCAA GCTACACCAT GGACAGCCAT
GGACGGAGCT CTTCTTGCCT AGACCACCTG GGTTCATCAA TGGAGAACAG TAGTATCCAT GGCAAGAGAG GTAACAACCG
GAGGTCGGGT CATGGTGTGT CTGCGCAAGA TGACGGCTGC GGGTTGGTTC TTGGATTGGG TCCATCGCCG GAGATGGGCT
CCTCCGCGGC GCGCAGGTCG AAAGCGCCGG CGCCGGCGAC ATTGTTCAGC CAGAGGAGCT TCTCCTTCAC TGAGCCAGGG
GTGCTCAGCC TTGGGCTTCA TCGGGGAGAT CATGGTGGCG CGACGATTCA GCATCTGGAA GAAGCGCCTG CTGGGAACAT
CATCTCCTTC GCCGCCGCCG TCGATGAGGG CTCGACGTCG GCGAGGAGGA GCTCCGGTGG GTACATGCCG TCGCTGCTCT
TCGCGCCTCG GCCCAACGCG TCGGCTCCTG AAGAGGCTCG TCATGATGTC GTGGCGGATC ACACGGACAA CACCGTGAGT
GGTGGTGGCG CGCGCCATGG CCATGCGCGG CGTCGCGTCG TTCGTCAGCT CAGCCCTGAG CCTGAGCCTG AGCCTTCGGC
GACCATGACG GAGACCTCGT TCGGTGTGAG CTCCGACGTG GTCACGACGG TGACCAATCC TGTGACGACG CAGCCGGCGG
CGGCGGCGGC GCAGTCGCAA CGCCGGCATC CGAAGAAGTG CAGGTTCAAG GGGTGCTCCA AAGGAGCGCG AGGCGCGTCG
GGGCTGTGCA TCGCCCATGG CGGCGGGCAG AGGTGCCAGA AGCCCGGGTG CCACAAGGGC GCCGAGAGCC GCACGGCCTA
CTGCAAGGCG CATGGCGGTG GCCGCCGGTG CATGCAGCTC GGCTGCACCA AGAGCGCCGA GGGGAAGACG GATCACTGCA
TCGCCCACGG CGGCGGCCGC CGGTGCGGGC ACCAGGGCTG CCCGAAGGCC GCGCGGGGGA AGTCCGGGCG GTGCATCAAG
CATGGCGGAG GGAAGAGGTG TTCGGTCGAG GGCTGCATCC GGAGCGCGGA GGGGAGGGTC GGGCTCTGCA TCTCCCACGG
CGGCGGGCGG CGGTGCCAGT ACCCGGACTG CCGAAAGGGC GCGCAGGGGA GCACGCTGTA CTGCAAGGCG CACGGCGGCG
GCAAGCGGTG CGTGTTCGAC GGGTGCCTCA AGGGCGCGGA GGGGAGCACG CCGCTGTGCA AGGCGCACGG CGGCGGGAAG
CGGTGCATGT TCGAGGGCGG CGGGCTCTGC CCCAAGAGCG TCCACGGCGG CACCAGCTTC TGCGTGGCGC ACGGCGGCGG
GAAGCGGTGC ACGGTGCCCG GGTGCGGCAA GAGCGCCCGC GGCCGCACGG ACTGCTGCGT CAAGCACGGC GGCGGCAAGC
GGTGCAGGGT CGACGGCTGC GCCAAGAGCG CGCAGGGGAG CACGGAGTTC TGCAAGGCCC ACGGCGGCGG CAAGCGCTGC
ACCTGGGCCA CCGGCTGCGA GAAGTTCGCC CGCGGGCGGA GCGGCCTCTG CGCCGCGCAC GGCACGCTCA TGGCCTCACA
GCAGCGTCGC GCCGGCGGCG GCGGGAGCAT GATCGGTCCA GGGCTCTTCC ACGGCCTCGT CGGCGCCATG AACAACGGCT
ACTCGTCCTC CGGCGTCAGC ACGGCGTCGG AGTACTCCGA CGCCTGCGAC GGCGCGGCGA GGAGGCAAGA GCTGATACCT
CCTCAGGTGC TGGTCCCGAA CTCCATGAAG TCGTCGTGCT CGTCGGCGCC GCCGCCGTCG ATGGGCAGGG GCAGAGAGGG
AGGAGGGTTC GTCGTCCCCG AGGGGAGGGT GCACGGTGGC GGCCTCCTGT CGTTGCTCGG CGGGAGCTTC AGGAACGTCG
ACGTCGACGA GCTCTGAAGC AGCAGCGCTC GTGTGAGAAA ATCAGTGTCA GTTTCTGCAT CTCAAAAAAC GGAGGAAAAA
AAACGAAGAG AAAAAAAGAA AGAGATTCTA TAGCTCATAT AGATGTTAGG TTGGTACGAA ACTTCATAGA TTGTTTTGAT
GTTATTATCG TGTCAAGATT CAAGTCTCAG GGCATGAACT TGTCAGGGGA TTTCAAATGT TTTGAGTTCG TTGTGAATAA
AATGTAGTAG ACATGAACTT GTCAGGGGAT TTC

Locus: Os02g0575700

Loading...

Locus: Os02g0575700

Loading...