Os02t0579800-01

Locus

Os02g0579800

Description

Similar to Fw2.2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL2

Oryzabase Gene Name Synonym(s)

FW2.2-like 2

Transcript Evidence

AK059931 (DDBJ, Best hit)

Protein Evidence

B6TYV8 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Uncharacterised protein family Cys-rich (IPR006461)

Full-length cDNA

006-210-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0579800-01)

RiceXPro (AK059931)

Others

Oryzabase (13471)

KEGG (Os02t0579800-01)

Transcript

983 bp

>Os02t0579800-01 Similar to Fw2.2.
AGTCCGCGATTCGGCCGGTTACCCTCTGATCGAGAGAGAGAGCCTCACACCCGAAGGCCG
GAGAGCGAGAGATCGACAAAGGCGCCGCGCCGGGGCAGCATGTACTCGAAACCGGAGGAC
GTCGGTGGAGGCGTCACCACCGCCTTCGCCATGCAGGGCAAGGTCCCCCTCGCCGCCTGG
TCCACCGGCCTCTTCAACTGCTTCGACGACTGCGGCAACTGTTGCGTGACGTGCCTGTGC
CCGTGCATCACGTTCGGGCAGATCGCGGAGATCATCGACCGGGGGTCGTCGTCGTGCGGG
ACGAGCGGGGCGCTGTACGCGCTGGTGATGCTCCTCACGGGCTGCAACTGCGTCTACTCC
TGCTTCTACCGCGCCAAGATGCGGTCCCAGTACGGCCTGCAGGAGAAGCCCTGCGCCGAC
TGCCCCGTCCACTTCTTCTGCGAGCCCTGCGCCCTCTCCCAGGAGTACCGCGAGCTCAAG
AAGCGCGGCTTCGACATGAACCTCGGATGGCACGCGAACATGGAGAGGCAGGGTCACAAG
CCGGCGATGACCATGCCGCCGCACATGTTCCCCGGGATGACACGCTGATCGATCGAGTGA
TCAGCGGCTTCTCTGCAAGAGATGGGCAAGGCAGGGCAGGGCAGGGCAGCTTGCTATATA
TGCCCTACATACGACTATACGAGCCAGATTTTTCTTGCGGGTTTGTAAAAAATAATTCAA
AATGTCTATAACTTATTACGCGTAATGCAAATTGCAAGAAGAATTTGATGGTTCGTAGAT
CACATAGCCAGGCTTAGCAGATGGGGAACTTGTTCTTGTTGGTTTCCCTCGGTTCCTTTT
TATATAAACCTACCAGCAGGTAGTTGTAATATGTATGCATGTATGTGCAATTTTCATTTC
TTGATGTGTATGCTGTTTCGTAAACCATGGCACATAGAAATGATTTCCGAATTCAGTATA
ATACAAATTTCCACTATTTGTGC

CDS

489 bp

>Os02t0579800-01 Similar to Fw2.2.
ATGTACTCGAAACCGGAGGACGTCGGTGGAGGCGTCACCACCGCCTTCGCCATGCAGGGC
AAGGTCCCCCTCGCCGCCTGGTCCACCGGCCTCTTCAACTGCTTCGACGACTGCGGCAAC
TGTTGCGTGACGTGCCTGTGCCCGTGCATCACGTTCGGGCAGATCGCGGAGATCATCGAC
CGGGGGTCGTCGTCGTGCGGGACGAGCGGGGCGCTGTACGCGCTGGTGATGCTCCTCACG
GGCTGCAACTGCGTCTACTCCTGCTTCTACCGCGCCAAGATGCGGTCCCAGTACGGCCTG
CAGGAGAAGCCCTGCGCCGACTGCCCCGTCCACTTCTTCTGCGAGCCCTGCGCCCTCTCC
CAGGAGTACCGCGAGCTCAAGAAGCGCGGCTTCGACATGAACCTCGGATGGCACGCGAAC
ATGGAGAGGCAGGGTCACAAGCCGGCGATGACCATGCCGCCGCACATGTTCCCCGGGATG
ACACGCTGA

Protein

163 aa

>Os02t0579800-01 Similar to Fw2.2.
MYSKPEDVGGGVTTAFAMQGKVPLAAWSTGLFNCFDDCGNCCVTCLCPCITFGQIAEIID
RGSSSCGTSGALYALVMLLTGCNCVYSCFYRAKMRSQYGLQEKPCADCPVHFFCEPCALS
QEYRELKKRGFDMNLGWHANMERQGHKPAMTMPPHMFPGMTR*

5'UTR

chr02:22312914..22313012 (- strand) : 99 bp

CDS

chr02:22312793..22312913 (- strand) : 121 bp

chr02:22312406..22312690 (- strand) : 285 bp

chr02:22312229..22312311 (- strand) : 83 bp

3'UTR

chr02:22311834..22312228 (- strand) : 395 bp

FASTA

>Os02t0579800-01 class=Sequence position=chr02:22311834..22313012 (- strand)
AGTCCGCGAT TCGGCCGGTT ACCCTCTGAT CGAGAGAGAG AGCCTCACAC CCGAAGGCCG GAGAGCGAGA GATCGACAAA
GGCGCCGCGC CGGGGCAGCA TGTACTCGAA ACCGGAGGAC GTCGGTGGAG GCGTCACCAC CGCCTTCGCC ATGCAGGGCA
AGGTCCCCCT CGCCGCCTGG TCCACCGGCC TCTTCAACTG CTTCGACGAC TGCGGCAACT GTAAGTAGTA ATCCCCCCCC
CCCCCCCGAT ACGGTTGTGT TCTTGCTCGA TCGGCATGGT GTGTGTGCGC TGATCGATGA TTGATCGTTG TGCGTGCGGC
AGGTTGCGTG ACGTGCCTGT GCCCGTGCAT CACGTTCGGG CAGATCGCGG AGATCATCGA CCGGGGGTCG TCGTCGTGCG
GGACGAGCGG GGCGCTGTAC GCGCTGGTGA TGCTCCTCAC GGGCTGCAAC TGCGTCTACT CCTGCTTCTA CCGCGCCAAG
ATGCGGTCCC AGTACGGCCT GCAGGAGAAG CCCTGCGCCG ACTGCCCCGT CCACTTCTTC TGCGAGCCCT GCGCCCTCTC
CCAGGAGTAC CGCGAGCTCA AGAAGCGCGG CTTCGACATG AACCTCGGTA AAACGACAAC CATTTTTCTG ATGGAATTTA
CTAGTACTGC TATATATGGT TGGTTGATCG TGACAACGAC GATTTCGTTG GTTTTGTGCA GGATGGCACG CGAACATGGA
GAGGCAGGGT CACAAGCCGG CGATGACCAT GCCGCCGCAC ATGTTCCCCG GGATGACACG CTGATCGATC GAGTGATCAG
CGGCTTCTCT GCAAGAGATG GGCAAGGCAG GGCAGGGCAG GGCAGCTTGC TATATATGCC CTACATACGA CTATACGAGC
CAGATTTTTC TTGCGGGTTT GTAAAAAATA ATTCAAAATG TCTATAACTT ATTACGCGTA ATGCAAATTG CAAGAAGAAT
TTGATGGTTC GTAGATCACA TAGCCAGGCT TAGCAGATGG GGAACTTGTT CTTGTTGGTT TCCCTCGGTT CCTTTTTATA
TAAACCTACC AGCAGGTAGT TGTAATATGT ATGCATGTAT GTGCAATTTT CATTTCTTGA TGTGTATGCT GTTTCGTAAA
CCATGGCACA TAGAAATGAT TTCCGAATTC AGTATAATAC AAATTTCCAC TATTTGTGC

Locus: Os02g0579800

Loading...

Locus: Os02g0579800

Loading...