Os02t0580000-01

Locus

Os02g0580000

Description

Similar to Cell number regulator 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL3, FWL3

Oryzabase Gene Name Synonym(s)

FW2.2-like 3, fruit-weight 2.2-like 3

Transcript Evidence

AK111738

Protein Evidence

Q6EP46

Literature

PMID: 23793979

Note

Manual Curation

December 2, 2016

Functional domain (InterPro)

PLAC8 motif-containing protein (IPR006461)

Full-length cDNA

J023047N05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0580000-01)

Others

Oryzabase (13472)

Transcript

1022 bp

>Os02t0580000-01 Similar to Cell number regulator 2.
GCCTCGTCGGAGAGAAAGCCTCACCCTCGCGGGCCGGAGAGTGAGGGATCGACGAAGGCG
CCCCGTACGTCGGGCCAGCATATATATACTCAGAAGCCGGAGGAGGACGGTGGAGGCGCC
ACCACCACCACCACCCTTCGCCATGCAGGACCAGGCCGCCCCCGTCCCATGGTCCACCGA
CCTCTTTGACTGCTTCGACGACAGCAGCAACTGTTTTATGACGTGGTTGTGCCCGTGCAT
CACGTTCGGGCAGATCGCGGAGATCGTCGACCGGGGGTCGTCGTCGTGCGGGACGAGCGG
GTCGCTGTACGCGCTGGTGTTTCTCGTCACGGGCTGCAGCTGTATCTACTCCTGCATCTA
CCGCTCCAAGCTGCGGTCCCAGTACGGCCTGCAGGAGACGCCCTGCCCCGACTGCCTCGT
CCACTTGTGGTGCGAGCCCTGCGCCCTCTGCCAGGAGTACCGCGAGCTCAAGAAGCGCGG
CTTCGACATGAGCCTCGGATGGCACGCAAACATGGAGAAGCAAGGGCAAAACCCGGCGGC
GACCATGGCGCCGGAGATGTACCCTGGGATGACACGCTGATCGATCGGCTAATCAGTGGG
TGATGCTGGCTGCTGCCCTGCTCGGTCGTTGTCTTCTCTGCTAGAGATGGGCAGGACAGG
GCAGGGCAGGGCAGCTTACTACGTGCCTACATACGAGCGAGATTTCTCTTGCGGGTTTGC
ACCAAAACAATACAAAAGGTCTATAACTATAGTACGCGTAATGCAATCTGCTAGAAGAAT
TTGATGGTTCATAGATCACGTAGCCAGGCTTAGCAGATGGGGAACTTGTTCTTGTTGGTT
TTCCAAGGTCCCTTTTTATATATACCTACCAGCCGGTAGTTGTATTATGCATGTATGCAA
TTTTCATTTCTTGATGTGTATGCAGTTTCGTAAAGCATATGGCATATCAAAGAAATGATT
TCGATTATGCCCTTTCTTAATTCAACCGAATTCAATATAATACAAATTTCCACTTTTTGT
GC

CDS

438 bp

>Os02t0580000-01 Similar to Cell number regulator 2.
ATGCAGGACCAGGCCGCCCCCGTCCCATGGTCCACCGACCTCTTTGACTGCTTCGACGAC
AGCAGCAACTGTTTTATGACGTGGTTGTGCCCGTGCATCACGTTCGGGCAGATCGCGGAG
ATCGTCGACCGGGGGTCGTCGTCGTGCGGGACGAGCGGGTCGCTGTACGCGCTGGTGTTT
CTCGTCACGGGCTGCAGCTGTATCTACTCCTGCATCTACCGCTCCAAGCTGCGGTCCCAG
TACGGCCTGCAGGAGACGCCCTGCCCCGACTGCCTCGTCCACTTGTGGTGCGAGCCCTGC
GCCCTCTGCCAGGAGTACCGCGAGCTCAAGAAGCGCGGCTTCGACATGAGCCTCGGATGG
CACGCAAACATGGAGAAGCAAGGGCAAAACCCGGCGGCGACCATGGCGCCGGAGATGTAC
CCTGGGATGACACGCTGA

Protein

146 aa

>Os02t0580000-01 Similar to Cell number regulator 2.
MQDQAAPVPWSTDLFDCFDDSSNCFMTWLCPCITFGQIAEIVDRGSSSCGTSGSLYALVF
LVTGCSCIYSCIYRSKLRSQYGLQETPCPDCLVHLWCEPCALCQEYRELKKRGFDMSLGW
HANMEKQGQNPAATMAPEMYPGMTR*

5'UTR

chr02:22321132..22321273 (- strand) : 142 bp

CDS

chr02:22321062..22321131 (- strand) : 70 bp

chr02:22320694..22320978 (- strand) : 285 bp

chr02:22320298..22320380 (- strand) : 83 bp

3'UTR

chr02:22319856..22320297 (- strand) : 442 bp

FASTA

>Os02t0580000-01 class=Sequence position=chr02:22319856..22321273 (- strand)
GCCTCGTCGG AGAGAAAGCC TCACCCTCGC GGGCCGGAGA GTGAGGGATC GACGAAGGCG CCCCGTACGT CGGGCCAGCA
TATATATACT CAGAAGCCGG AGGAGGACGG TGGAGGCGCC ACCACCACCA CCACCCTTCG CCATGCAGGA CCAGGCCGCC
CCCGTCCCAT GGTCCACCGA CCTCTTTGAC TGCTTCGACG ACAGCAGCAA CTGTAAAATA AGCAAGCCGG GCTACGATTG
TGTGTTCTCT GCTTGGCGTG GTACGTGTGT GCTGATCGAT TGTTGTCGGG CGCAGGTTTT ATGACGTGGT TGTGCCCGTG
CATCACGTTC GGGCAGATCG CGGAGATCGT CGACCGGGGG TCGTCGTCGT GCGGGACGAG CGGGTCGCTG TACGCGCTGG
TGTTTCTCGT CACGGGCTGC AGCTGTATCT ACTCCTGCAT CTACCGCTCC AAGCTGCGGT CCCAGTACGG CCTGCAGGAG
ACGCCCTGCC CCGACTGCCT CGTCCACTTG TGGTGCGAGC CCTGCGCCCT CTGCCAGGAG TACCGCGAGC TCAAGAAGCG
CGGCTTCGAC ATGAGCCTCG GTAACaggaa gtttaacagt acagccaact accaactcca aatcatttat aattaattta
atagttaatt gatacaatag ttatctactg cactattaat tcctggtccc acatgttata cacacattgc gtatttgagt
ctgtgctgca gctggctaca aatctgtagt ccactgctcg tctctctact cttttatctt cttaaaatat gttAAAATAT
GTTTATAGCA TAGCCATCGA TTTTCTAATG GAATGGTTGG CTGTCGTGCG TGTTGATGAT CGTGACGATG ACGATTTCGT
TGGTTTTGTG CAGGATGGCA CGCAAACATG GAGAAGCAAG GGCAAAACCC GGCGGCGACC ATGGCGCCGG AGATGTACCC
TGGGATGACA CGCTGATCGA TCGGCTAATC AGTGGGTGAT GCTGGCTGCT GCCCTGCTCG GTCGTTGTCT TCTCTGCTAG
AGATGGGCAG GACAGGGCAG GGCAGGGCAG CTTACTACGT GCCTACATAC GAGCGAGATT TCTCTTGCGG GTTTGCACCA
AAACAATACA AAAGGTCTAT AACTATAGTA CGCGTAATGC AATCTGCTAG AAGAATTTGA TGGTTCATAG ATCACGTAGC
CAGGCTTAGC AGATGGGGAA CTTGTTCTTG TTGGTTTTCC AAGGTCCCTT TTTATATATA CCTACCAGCC GGTAGTTGTA
TTATGCATGT ATGCAATTTT CATTTCTTGA TGTGTATGCA GTTTCGTAAA GCATATGGCA TATCAAAGAA ATGATTTCGA
TTATGCCCTT TCTTAATTCA ACCGAATTCA ATATAATACA AATTTCCACT TTTTGTGC

Locus: Os02g0580000

Loading...

Locus: Os02g0580000

Loading...