Os02t0580000-02

Locus

Os02g0580000

Description

Fruit-weight 2.2-like protein, Negative regulation of grain length

RAP-DB Gene Symbol Synonym(s)

OsFWL3

RAP-DB Gene Name Synonym(s)

FW2.2-like 3

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL3, FWL3

Oryzabase Gene Name Synonym(s)

FW2.2-like 3, fruit-weight 2.2-like 3

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 23793979

Note

Manual Curation

December 2, 2016

Functional domain (InterPro)

PLAC8 motif-containing protein (IPR006461)

Others

Oryzabase (13472)

Transcript

1044 bp

>Os02t0580000-02 Fruit-weight 2.2-like protein, Negative regulation of grain length
TTAGCCTCGTCGGAGAGAAAGCCTCACCCTCGCGGGCCGGAGAGTGAGGGATCGACGAAG
GCGCCCCGTACGTCGGGCCAGCATATATATACTCAGAAGCCGGAGGAGGACGGTGGAGGC
GCCACCACCACCACCACCCTTCGCCATGCAGGACCAGGCCGCCCCCGTCCCATGGTCCAC
CGACCTCTTTGACTGCTTCGACGACAGCAGCAACTGTTTTATGACGTGGTTGTGCCCGTG
CATCACGTTCGGGCAGATCGCGGAGATCGTCGACCGGGGGTCGTCGTCGTGCGGGACGAG
CGGGTCGCTGTACGCGCTGGTGTTTCTCGTCACGGGCTGCAGCTGTATCTACTCCTGCAT
CTACCGCTCCAAGCTGCGGTCCCAGTACGGCCTGCAGGAGACGCCCTGCCCCGACTGCCT
CGTCCACTTGTGGTGCGAGCCCTGCGCCCTCTGCCAGGAGTACCGCGAGCTCAAGAAGCG
CGGCTTCGACATGAGCCTCGGTAACaggaagtttaacaGATGGCACGCAAACATGGAGAA
GCAAGGGCAAAACCCGGCGGCGACCATGGCGCCGGAGATGTACCCTGGGATGACACGCTG
ATCGATCGGCTAATCAGTGGGTGATGCTGGCTGCTGCCCTGCTCGGTCGTTGTCTTCTCT
GCTAGAGATGGGCAGGACAGGGCAGGGCAGGGCAGCTTACTACGTGCCTACATACGAGCG
AGATTTCTCTTGCGGGTTTGCACCAAAACAATACAAAAGGTCTATAACTATAGTACGCGT
AATGCAATCTGCTAGAAGAATTTGATGGTTCATAGATCACGTAGCCAGGCTTAGCAGATG
GGGAACTTGTTCTTGTTGGTTTTCCAAGGTCCCTTTTTATATATACCTACCAGCCGGTAG
TTGTATTATGCATGTATGCAATTTTCATTTCTTGATGTGTATGCAGTTTCGTAAAGCATA
TGGCATATCAAAGAAATGATTTCGATTATGCCCTTTCTTAATTCAACCGAATTCAATATA
ATACAAATTTCCACTTTTTGTGCA

CDS

456 bp

>Os02t0580000-02 Fruit-weight 2.2-like protein, Negative regulation of grain length
ATGCAGGACCAGGCCGCCCCCGTCCCATGGTCCACCGACCTCTTTGACTGCTTCGACGAC
AGCAGCAACTGTTTTATGACGTGGTTGTGCCCGTGCATCACGTTCGGGCAGATCGCGGAG
ATCGTCGACCGGGGGTCGTCGTCGTGCGGGACGAGCGGGTCGCTGTACGCGCTGGTGTTT
CTCGTCACGGGCTGCAGCTGTATCTACTCCTGCATCTACCGCTCCAAGCTGCGGTCCCAG
TACGGCCTGCAGGAGACGCCCTGCCCCGACTGCCTCGTCCACTTGTGGTGCGAGCCCTGC
GCCCTCTGCCAGGAGTACCGCGAGCTCAAGAAGCGCGGCTTCGACATGAGCCTCGGTAAC
aggaagtttaacaGATGGCACGCAAACATGGAGAAGCAAGGGCAAAACCCGGCGGCGACC
ATGGCGCCGGAGATGTACCCTGGGATGACACGCTGA

Protein

152 aa

>Os02t0580000-02 Fruit-weight 2.2-like protein, Negative regulation of grain length
MQDQAAPVPWSTDLFDCFDDSSNCFMTWLCPCITFGQIAEIVDRGSSSCGTSGSLYALVF
LVTGCSCIYSCIYRSKLRSQYGLQETPCPDCLVHLWCEPCALCQEYRELKKRGFDMSLGN
RKFNRWHANMEKQGQNPAATMAPEMYPGMTR*

5'UTR

chr02:22321132..22321276 (- strand) : 145 bp

CDS

chr02:22321062..22321131 (- strand) : 70 bp

chr02:22320676..22320978 (- strand) : 303 bp

chr02:22320298..22320380 (- strand) : 83 bp

3'UTR

chr02:22319855..22320297 (- strand) : 443 bp

FASTA

>Os02t0580000-02 class=Sequence position=chr02:22319855..22321276 (- strand)
TTAGCCTCGT CGGAGAGAAA GCCTCACCCT CGCGGGCCGG AGAGTGAGGG ATCGACGAAG GCGCCCCGTA CGTCGGGCCA
GCATATATAT ACTCAGAAGC CGGAGGAGGA CGGTGGAGGC GCCACCACCA CCACCACCCT TCGCCATGCA GGACCAGGCC
GCCCCCGTCC CATGGTCCAC CGACCTCTTT GACTGCTTCG ACGACAGCAG CAACTGTAAA ATAAGCAAGC CGGGCTACGA
TTGTGTGTTC TCTGCTTGGC GTGGTACGTG TGTGCTGATC GATTGTTGTC GGGCGCAGGT TTTATGACGT GGTTGTGCCC
GTGCATCACG TTCGGGCAGA TCGCGGAGAT CGTCGACCGG GGGTCGTCGT CGTGCGGGAC GAGCGGGTCG CTGTACGCGC
TGGTGTTTCT CGTCACGGGC TGCAGCTGTA TCTACTCCTG CATCTACCGC TCCAAGCTGC GGTCCCAGTA CGGCCTGCAG
GAGACGCCCT GCCCCGACTG CCTCGTCCAC TTGTGGTGCG AGCCCTGCGC CCTCTGCCAG GAGTACCGCG AGCTCAAGAA
GCGCGGCTTC GACATGAGCC TCGGTAACag gaagtttaac agtacagcca actaccaact ccaaatcatt tataattaat
ttaatagtta attgatacaa tagttatcta ctgcactatt aattcctggt cccacatgtt atacacacat tgcgtatttg
agtctgtgct gcagctggct acaaatctgt agtccactgc tcgtctctct actcttttat cttcttaaaa tatgttAAAA
TATGTTTATA GCATAGCCAT CGATTTTCTA ATGGAATGGT TGGCTGTCGT GCGTGTTGAT GATCGTGACG ATGACGATTT
CGTTGGTTTT GTGCAGGATG GCACGCAAAC ATGGAGAAGC AAGGGCAAAA CCCGGCGGCG ACCATGGCGC CGGAGATGTA
CCCTGGGATG ACACGCTGAT CGATCGGCTA ATCAGTGGGT GATGCTGGCT GCTGCCCTGC TCGGTCGTTG TCTTCTCTGC
TAGAGATGGG CAGGACAGGG CAGGGCAGGG CAGCTTACTA CGTGCCTACA TACGAGCGAG ATTTCTCTTG CGGGTTTGCA
CCAAAACAAT ACAAAAGGTC TATAACTATA GTACGCGTAA TGCAATCTGC TAGAAGAATT TGATGGTTCA TAGATCACGT
AGCCAGGCTT AGCAGATGGG GAACTTGTTC TTGTTGGTTT TCCAAGGTCC CTTTTTATAT ATACCTACCA GCCGGTAGTT
GTATTATGCA TGTATGCAAT TTTCATTTCT TGATGTGTAT GCAGTTTCGT AAAGCATATG GCATATCAAA GAAATGATTT
CGATTATGCC CTTTCTTAAT TCAACCGAAT TCAATATAAT ACAAATTTCC ACTTTTTGTG CA

Locus: Os02g0580000

Loading...

Locus: Os02g0580000

Loading...