Os02t0590800-01

Locus

Os02g0590800

Description

Tubulin complex-related serine/threonine protein kinase

RAP-DB Gene Symbol Synonym(s)

OsNek6

RAP-DB Gene Name Synonym(s)

NIMA-related kinase 6

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek6

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 6

Transcript Evidence

Q6YY75 (UniProt)

Inferred from literature

Protein Evidence

Q6YY75

Literature

PMID: 22067990

PMID: 21719639

Note

Manual Curation

August 7, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

Expression Databases

TENOR (Os02t0590800-00)

Others

Oryzabase (9921)

KEGG (Os02t0590800-00 (EC:2.7.11.1))

Transcript

2190 bp

>Os02t0590800-01 Tubulin complex-related serine/threonine protein kinase
ACGCAAAAGCCCAGAGGCAAGTAGCAGCAGCAGTGGTTGCGCGGTGCTGCGTTCGTCTCG
GTCTCCGTCTCCGTCGTCTCCGTCCACTGGACAGGGCAGAGGCTGCCTACCAGACACACG
CCCTCAACCTCGCGCCCGCCATTATTGCGACCCTCCCGCACGCGTGCGCGCGCGCGTATT
ATCACGAGGTCCGCGAGCGAGGCGCAGAGCAGAGAGCAGAAGCATCATTTCTAGTCCCCC
AGCCCAAGCAACAGTAGCCAGCAAGAACAGAGTAGGGAGGAGGAGGAGGAAGGAGGACGC
ACCTGGGAGCAGAGCCAGAGCCAGAGCCAGAGCCATGGAGCAGTACGAGGTGGTGGAGCA
GATCGGCCGGGGCGCCTACGGCTCCGCATACCTCGTCGTCCACAAGGGCGAGCGCAAGAG
GTACGTGATGAAGAAGATCCGGCTGTCCAAGCAGAACGACAAGTTCCAGCGCACGGCGTA
CCAGGAGATGTCCCTGATGGCGAGCCTCAGCAACCCGTACATCGTCGAGTACAAGGACGG
TTGGGTTGATGAAGGGACCTCGGCATGCATTGTGACAAGTTACTGTGAAGGAGGTGACAT
GGCAGAGAGGATCAAGAAGGCAAGGGGTGTCCTTTTCTCTGAAGAGAGGGTGTGCCGATG
GTTCACACAATTGCTCTTGGCCCTTGACTATCTGCACTGCAACCGTGTGCTCCACCGTGA
CCTCAAGTGTTCCAACATTTTGTTAACAAAGGATAATAACATCCGTCTTGCTGATTTTGG
GCTAGCAAAATTGCTCATGGAGGACCTTGCATCGACGATTGTGGGAACCCCAAACTACAT
GTGCCCAGAAATACTAGCAGACATACCTTATGGTTACAAATCTGATATATGGTCACTTGG
ATGCTGTATGTTTGAGATCTTAGCACACCGCCCTGCATTCAAAGCTGCAGACATGGCATC
ATTAATTAACAAAATAAACAGATCTTCAATATCTCCAATGCCACCGATATATTCATCATC
ACTGAAGCAGATAGTGAAGAGCATGCTAAGGAAAAACCCAGAACATAGACCCACTGCTGG
AGAACTATTGAGGCACCCATATTTGCAGCCTTATCTAGCTGAATCATGCAGCTGCTCCCC
AATCTACCTTCCAGTGAAGCCCACCAAAAGTAACCTGGGAGACAAGCAGCAGTCAAGAAA
ACCAGGCAGTGGCAGAAAGCGAATCATCAAAACCAATGGATCCAGTGAAGCATTAGAAAC
CGCTGCAGAGCAAGCTGTGGATACAAGAGACAACTCCACATATATTTCAGATGTTTCAAC
AGTTGGTACCCAGGACGCCTGCATTTCACAAGTATCTGTGGATCCTCAAGCTAGAAACAA
AGCATATCAAAACATCGATGATTTGACGCTTTTTCAACAGATAGAGGAAAATTTGATGAC
AATAACCGATCGACAGATTGATGAGGCCATCTTTCTTAAAGCTGTAAGAACCAGCAGCAC
AGTAGATGTCGTGCCAGTCTCTGGTGCAATTCAGAAGCCTAATGAGGCACCAATACCAAA
GGAGGAACTGACCATTGGAGTAGTGCAAGAGCAGAGAAAGGAAGTGAAAGCACACACTCA
CCAAGGATCAAAACCAGGCACAGGAGACGTTCCCATCGTTACAGAAGAATCATCACCGAA
GAGCGCGGTGAAATTGGCACATTCAGATAGCACTCCTGCCGAGTGGGACCATCTGAACAT
AGTGCAGCAGAGAGCTGACGCACTGGAGTCGCTACTCGAGCTTTGCGCCAAGCTGCTGAA
GCAGGAGAGGCTTGAGGAGCTTGCTGGCGTTCTCAGACCGTTTGGGGAAGGTGCTGTGTC
GTCCAGAGAGACGGCGATATGGCTGACAAAAAGCCTCATGACCCCACCAAAATTGGAAGG
GTCACCAAAACTTACGTAGGGGAGCGAATTTCATGGCTTTGTTTGCAAGTGTGCTGTTCT
GGTTCTGAGAGTGTATATAGCTTTGCTACAGTTCATGATTCTGTATCACTGAGGCTCGAG
TTTCTATTTATCTTGATGTATATGGTTTGAGTGAGCGAGGGCATTGTGTGAGCTAACTAT
TTATCAGATATTTACTGTACAATGGCATGTGCTGTTTGGCTGATTCAAGTAATAATGGAA
ATCATACCATGTTCATTCCTATTTTCTTCC

CDS

1605 bp

>Os02t0590800-01 Tubulin complex-related serine/threonine protein kinase
ATGGAGCAGTACGAGGTGGTGGAGCAGATCGGCCGGGGCGCCTACGGCTCCGCATACCTC
GTCGTCCACAAGGGCGAGCGCAAGAGGTACGTGATGAAGAAGATCCGGCTGTCCAAGCAG
AACGACAAGTTCCAGCGCACGGCGTACCAGGAGATGTCCCTGATGGCGAGCCTCAGCAAC
CCGTACATCGTCGAGTACAAGGACGGTTGGGTTGATGAAGGGACCTCGGCATGCATTGTG
ACAAGTTACTGTGAAGGAGGTGACATGGCAGAGAGGATCAAGAAGGCAAGGGGTGTCCTT
TTCTCTGAAGAGAGGGTGTGCCGATGGTTCACACAATTGCTCTTGGCCCTTGACTATCTG
CACTGCAACCGTGTGCTCCACCGTGACCTCAAGTGTTCCAACATTTTGTTAACAAAGGAT
AATAACATCCGTCTTGCTGATTTTGGGCTAGCAAAATTGCTCATGGAGGACCTTGCATCG
ACGATTGTGGGAACCCCAAACTACATGTGCCCAGAAATACTAGCAGACATACCTTATGGT
TACAAATCTGATATATGGTCACTTGGATGCTGTATGTTTGAGATCTTAGCACACCGCCCT
GCATTCAAAGCTGCAGACATGGCATCATTAATTAACAAAATAAACAGATCTTCAATATCT
CCAATGCCACCGATATATTCATCATCACTGAAGCAGATAGTGAAGAGCATGCTAAGGAAA
AACCCAGAACATAGACCCACTGCTGGAGAACTATTGAGGCACCCATATTTGCAGCCTTAT
CTAGCTGAATCATGCAGCTGCTCCCCAATCTACCTTCCAGTGAAGCCCACCAAAAGTAAC
CTGGGAGACAAGCAGCAGTCAAGAAAACCAGGCAGTGGCAGAAAGCGAATCATCAAAACC
AATGGATCCAGTGAAGCATTAGAAACCGCTGCAGAGCAAGCTGTGGATACAAGAGACAAC
TCCACATATATTTCAGATGTTTCAACAGTTGGTACCCAGGACGCCTGCATTTCACAAGTA
TCTGTGGATCCTCAAGCTAGAAACAAAGCATATCAAAACATCGATGATTTGACGCTTTTT
CAACAGATAGAGGAAAATTTGATGACAATAACCGATCGACAGATTGATGAGGCCATCTTT
CTTAAAGCTGTAAGAACCAGCAGCACAGTAGATGTCGTGCCAGTCTCTGGTGCAATTCAG
AAGCCTAATGAGGCACCAATACCAAAGGAGGAACTGACCATTGGAGTAGTGCAAGAGCAG
AGAAAGGAAGTGAAAGCACACACTCACCAAGGATCAAAACCAGGCACAGGAGACGTTCCC
ATCGTTACAGAAGAATCATCACCGAAGAGCGCGGTGAAATTGGCACATTCAGATAGCACT
CCTGCCGAGTGGGACCATCTGAACATAGTGCAGCAGAGAGCTGACGCACTGGAGTCGCTA
CTCGAGCTTTGCGCCAAGCTGCTGAAGCAGGAGAGGCTTGAGGAGCTTGCTGGCGTTCTC
AGACCGTTTGGGGAAGGTGCTGTGTCGTCCAGAGAGACGGCGATATGGCTGACAAAAAGC
CTCATGACCCCACCAAAATTGGAAGGGTCACCAAAACTTACGTAG

Protein

535 aa

>Os02t0590800-01 Tubulin complex-related serine/threonine protein kinase
MEQYEVVEQIGRGAYGSAYLVVHKGERKRYVMKKIRLSKQNDKFQRTAYQEMSLMASLSN
PYIVEYKDGWVDEGTSACIVTSYCEGGDMAERIKKARGVLFSEERVCRWFTQLLLALDYL
HCNRVLHRDLKCSNILLTKDNNIRLADFGLAKLLMEDLASTIVGTPNYMCPEILADIPYG
YKSDIWSLGCCMFEILAHRPAFKAADMASLINKINRSSISPMPPIYSSSLKQIVKSMLRK
NPEHRPTAGELLRHPYLQPYLAESCSCSPIYLPVKPTKSNLGDKQQSRKPGSGRKRIIKT
NGSSEALETAAEQAVDTRDNSTYISDVSTVGTQDACISQVSVDPQARNKAYQNIDDLTLF
QQIEENLMTITDRQIDEAIFLKAVRTSSTVDVVPVSGAIQKPNEAPIPKEELTIGVVQEQ
RKEVKAHTHQGSKPGTGDVPIVTEESSPKSAVKLAHSDSTPAEWDHLNIVQQRADALESL
LELCAKLLKQERLEELAGVLRPFGEGAVSSRETAIWLTKSLMTPPKLEGSPKLT*

5'UTR

chr02:22825887..22826220 (- strand) : 334 bp

CDS

chr02:22825801..22825886 (- strand) : 86 bp

chr02:22825637..22825703 (- strand) : 67 bp

chr02:22825316..22825381 (- strand) : 66 bp

chr02:22825164..22825210 (- strand) : 47 bp

chr02:22825020..22825065 (- strand) : 46 bp

chr02:22824826..22824906 (- strand) : 81 bp

chr02:22824696..22824738 (- strand) : 43 bp

chr02:22824548..22824594 (- strand) : 47 bp

chr02:22823693..22823774 (- strand) : 82 bp

chr02:22823560..22823609 (- strand) : 50 bp

chr02:22823403..22823476 (- strand) : 74 bp

chr02:22823266..22823317 (- strand) : 52 bp

chr02:22822315..22823178 (- strand) : 864 bp

3'UTR

chr02:22822064..22822314 (- strand) : 251 bp

FASTA

>Os02t0590800-01 class=Sequence position=chr02:22822064..22826220 (- strand)
ACGCAAAAGC CCAGAGGCAA GTAGCAGCAG CAGTGGTTGC GCGGTGCTGC GTTCGTCTCG GTCTCCGTCT CCGTCGTCTC
CGTCCACTGG ACAGGGCAGA GGCTGCCTAC CAGACACACG CCCTCAACCT CGCGCCCGCC ATTATTGCGA CCCTCCCGCA
CGCGTGCGCG CGCGCGTATT ATCACGAGGT CCGCGAGCGA GGCGCAGAGC AGAGAGCAGA AGCATCATTT CTAGTCCCCC
AGCCCAAGCA ACAGTAGCCA GCAAGAACAG AGTAGGGAGG AGGAGGAGGA AGGAGGACGC ACCTGGGAGC AGAGCCAGAG
CCAGAGCCAG AGCCATGGAG CAGTACGAGG TGGTGGAGCA GATCGGCCGG GGCGCCTACG GCTCCGCATA CCTCGTCGTC
CACAAGGGCG AGCGCAAGAG GTTCTCCTCC TTCCTCTGCT CCCCTTTCCT CTTCTTCCTT CGTCTTCTTC AGGCTTCCCT
GATGCTTCTG TTCTTTCTTG GCTCGATGAT GGTGCAGGTA CGTGATGAAG AAGATCCGGC TGTCCAAGCA GAACGACAAG
TTCCAGCGCA CGGCGTACCA GGAGGTAAAC CAGATCGAAA CCCTCGTTAG TTCTTGTTCA TTCCCCACAC TTGAGCAAAC
ATGTTGCACC CATGAGTTGT TTGCTGTTGC GTCTGCAAAA CCCTTTTGAG ATTACCAGAA ATTACTGCGC GATGGATTAA
AGAAAATAGC TTTTTTTTTT CTTTTCGAGT TCATACCTGA TTGAATGTTT GGGAGGACGG GACAGATGGT TTGGTTTGAT
GATTTGATTT TGATGCTTTG CTTGCTGTTT GCTGCACAGA TGTCCCTGAT GGCGAGCCTC AGCAACCCGT ACATCGTCGA
GTACAAGGAC GGTTGGGTTG ATGAAGTACA AATTCCACGC ATTAATTCAG TTCTGGGAGT AATTTGCATT CCTTCGAATC
AAGGGTTCTA AAGTTTTGTC CTTTTTTCTC TTCTTCGATG ATGGTTGCAG GGGACCTCGG CATGCATTGT GACAAGTTAC
TGTGAAGGAG GTGACATGTA AGAACCTCTC ACATTTTTCA CTCTTCACTG CCTCCTAAAA TTTTTACCTT CCATTGGTGC
TCCAACCTCC AAAGTCACTG ACATCGGAAT CACAGGGCAG AGAGGATCAA GAAGGCAAGG GGTGTCCTTT TCTCTGAAGA
GGTAAGAACA CCGTAAGTAG ATGAAATGGT GATTTTACCA CCTATATCAA TGAGCAGTAC AAACTGTTCA TGGATTGGAA
ACTTACCGCT GATTTGGTAC TTGTATGATC AAAGAGGGTG TGCCGATGGT TCACACAATT GCTCTTGGCC CTTGACTATC
TGCACTGCAA CCGTGTGCTC CACCGTGACC TCAAGGTAAA TGAACATTGT CCCTATCCAC ACAAGTCGAT TCATCAGGTA
TCAGCATCAC CTAACATGCC CTTGGCTCCT GTGCTGTTAC AGTGTTCCAA CATTTTGTTA ACAAAGGATA ATAACATCCG
TCTTGGTAAG AAATATATAT TTCACCATAA ATATAAATTA CTGCATCTTT CCTTTTTCTT GGATGATAGT GTAGTGACCT
GAATATTCAT TGTTTCTTGA AAACAGCTGA TTTTGGGCTA GCAAAATTGC TCATGGAGGA CCTTGCATCG ACGGTATGGC
TTAAACCTGT GCTATCATGT TGTGTAAATA TAACTCGCAA AACACATTTC CAGGTAGCAA AGAATACATA ACTATGCAGT
TACCTACATA AAGTCACACT AAATCATAAC ATGTATAAAC ACCATTCATG TAAACCCTTT TGATTTTGAA TAGTGGTTCA
TAACTAAATT CTTTATGGCT TATGATCTTC AATCGTACTA GCAGAATGCC CGTACTTTGT TACGGAATTC AAAAGAAAAA
TTGTATGGTA TTACATATTC ATGTGGGAAA AATTAATGTC TGCATCACGA AATACAATAG CTTTGAACTT TGATTTTTAA
CTGTATATAA TTTTTTTTTC ACttgtctta ttaataatca tgaaaagaga ttgaacaaca aaaattggca aaaaaaaaTA
TGCCCCTTAA TTTTATTCTA AAATTAAATA TGTAAGTACC CACTTCTCTC TTTAGTTGAA AAAAAAGATG CTTTTATGCT
CCCTTCTACT TTGACCTTGA GTACATATGA AGGCCCGCTC GTCATTGATG GCCACCACCA TTGCCTTCTT TTATGATGGT
ATAGATAATG GAATTTTGTT CTAGAAATAT GTGATGCCAT TTCAGTATAG TTCCGGCAGT GTTATTTCAT TTGTATATAT
TTATTTATAG AATTATATAT GAACAGTAGG ACACTTTCCT ACCTTCTTCA TTCAAAATAT TGTGACATGT GAATGAACTG
ATAGGTTCCA TTGCCACTCA ATGAATTCAA CATCTATGTT TTTCAGATTG TGGGAACCCC AAACTACATG TGCCCAGAAA
TACTAGCAGA CATACCTTAT GGTTACAAAT CTGATATATG GTCACTTGGT GAGTTCCCAG TACAACAGCT TTTGGAGTAA
TTTTCACGGT TTCTGTTATG ATGCTAATCC TTTCCCATCT TTTACCATCA GGATGCTGTA TGTTTGAGAT CTTAGCACAC
CGCCCTGCAT TCAAAGCTGC AGTAAGTCCT ACTACACAAT TCAAACGATA AATTACTGTT TACGTATAAC ATGGTTCATG
AAATATCCCC TCTTGTTTTT TAAGGACATG GCATCATTAA TTAACAAAAT AAACAGATCT TCAATATCTC CAATGCCACC
GATATATTCA TCATCACTGT GAGTGCCAAT ATTATTAACT TTTTAATGAT TTTCCCATAA TATATATCAG AATTTATGCT
AAACATGATG CTTTGTTTGG CAGGAAGCAG ATAGTGAAGA GCATGCTAAG GAAAAACCCA GAACATAGAC CCACTGTAAG
TACCACAAAC TCAGTTTCAC TGTTTCAATC AAAGGCACCG ACAGAACACT TCACATTCAA AGTTAAACTG AAAAATTTAC
AGGCTGGAGA ACTATTGAGG CACCCATATT TGCAGCCTTA TCTAGCTGAA TCATGCAGCT GCTCCCCAAT CTACCTTCCA
GTGAAGCCCA CCAAAAGTAA CCTGGGAGAC AAGCAGCAGT CAAGAAAACC AGGCAGTGGC AGAAAGCGAA TCATCAAAAC
CAATGGATCC AGTGAAGCAT TAGAAACCGC TGCAGAGCAA GCTGTGGATA CAAGAGACAA CTCCACATAT ATTTCAGATG
TTTCAACAGT TGGTACCCAG GACGCCTGCA TTTCACAAGT ATCTGTGGAT CCTCAAGCTA GAAACAAAGC ATATCAAAAC
ATCGATGATT TGACGCTTTT TCAACAGATA GAGGAAAATT TGATGACAAT AACCGATCGA CAGATTGATG AGGCCATCTT
TCTTAAAGCT GTAAGAACCA GCAGCACAGT AGATGTCGTG CCAGTCTCTG GTGCAATTCA GAAGCCTAAT GAGGCACCAA
TACCAAAGGA GGAACTGACC ATTGGAGTAG TGCAAGAGCA GAGAAAGGAA GTGAAAGCAC ACACTCACCA AGGATCAAAA
CCAGGCACAG GAGACGTTCC CATCGTTACA GAAGAATCAT CACCGAAGAG CGCGGTGAAA TTGGCACATT CAGATAGCAC
TCCTGCCGAG TGGGACCATC TGAACATAGT GCAGCAGAGA GCTGACGCAC TGGAGTCGCT ACTCGAGCTT TGCGCCAAGC
TGCTGAAGCA GGAGAGGCTT GAGGAGCTTG CTGGCGTTCT CAGACCGTTT GGGGAAGGTG CTGTGTCGTC CAGAGAGACG
GCGATATGGC TGACAAAAAG CCTCATGACC CCACCAAAAT TGGAAGGGTC ACCAAAACTT ACGTAGGGGA GCGAATTTCA
TGGCTTTGTT TGCAAGTGTG CTGTTCTGGT TCTGAGAGTG TATATAGCTT TGCTACAGTT CATGATTCTG TATCACTGAG
GCTCGAGTTT CTATTTATCT TGATGTATAT GGTTTGAGTG AGCGAGGGCA TTGTGTGAGC TAACTATTTA TCAGATATTT
ACTGTACAAT GGCATGTGCT GTTTGGCTGA TTCAAGTAAT AATGGAAATC ATACCATGTT CATTCCTATT TTCTTCC

Locus: Os02g0590800

Loading...

Locus: Os02g0590800

Loading...