Os02t0593600-01

Locus

Os02g0593600

Description

Leucine-rich repeat, typical subtype containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL2

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 2

Transcript Evidence

AK069976 (DDBJ, Best hit)

Protein Evidence

Q01IY1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J023035N02 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0593600-01)

RiceXPro (AK069976)

Others

Oryzabase (14433)

KEGG (Os02t0593600-01)

Transcript

1859 bp

>Os02t0593600-01 Leucine-rich repeat, typical subtype containing protein.
TTCTTTTTCGCCACCCGATCCGGCAACAACAACGTACGTAACCTCCtctctctctctctc
tctctctccccttccagccgcgcgcgcgcacgcacgccgccgtcgtgacgtcgccgtcgc
ggtcgccgccatggatccgacgccgcagtcgcacccgatcctggcgtacgtgctgtcgcg
gctcccgtcgctgctgccggtgtcgccgtcgctgtccaccccgcgcgcgcgGGACATCGA
Gcagccgtccccgcgggcgccgtcgggcgccgcggagttcgacctcgtcagccgcatgcc
ggggctccgccacccgtccgtcctctccgccatgacgcgcgccgtcgccgacgtctcctc
ggcgcgcgacgcgctccgcctcctcggcccccgccccgaccacgagctcgtcgactccgc
ccgCGCCTTCCTCCGCTCCCACGCCGCCGAAGAGGCCGAAGAGGAGGAGGAGGACGAGAA
GGTGGCGAAGAGCCGGGAGGTGGTGCGGCTGGACGAGGCGCACGAGTCGTACGGTGGCTT
GCTGCGGGAGGCGGAGGAGAGGCTGGATCGCGTGTACCGGACGGCGATGAGAGGGAGGGA
CATGCAGGTGGTGGCCGCGGCGCACGGCGGTGGCGGGGAGGAGGAGGCCGGGGTGGTGGA
CGACGAGGTGGTGCGGGTGCTCCGGGACGCGGAGGAAGGGAAGGCGGTGGAGCGCCTCCT
CCTCGCCGACCGGCAGCTCCGCCACCTGCCCGAGCAGCTCGGCCGGATCCGCGGCCTCCT
CGTCCTCGACGTCTCGCGAAATCAGCTCAAGAATGTCCCAGATGCCATAGGCGGGCTCGA
ACACCTGGAAGAGCTTCGCCTCGCTTCCAACGCGTTGGTCTCCCTCCCGGACTCCATAGG
CCTCCTCACCAGCCTCAAGATCCTCGACGTCTCGGGCAACAAGCTGAGGTCTCTCCCCGA
CAGCATCTCAAAATGCAGGTCGCTGGTGGAGCTGGACGTGAGCTACAACGTGCTGTCGTA
CCTCCCGACGGGGATCGGGCAGGAGATGGCGAGGCTGGAGAAGCTGTGGGTGCACCTGAA
CAAGCTGCGGTCGCTGCCGTCGTCGGTGTGCGAGATGCGGTCGCTGCGCCTCCTGGACGC
GCACTTCAACCAGCTCCGGGGGCTCCCCGCGGGGATCGGGAGGCTGGCGGCGCTGGAGTC
GCTCAACCTCAGCAGCAACTTCAGCGACATGCGCGACCTCCCGGCGTCGTTCGGGGACCT
GCTCGGCCTGCGCGAGCTCGACCTCAGCAACAACCAGATACACGCGCTCCCGGACTGCTT
CGGCCGCCTCCAGCGCCTCGAGCGGCTCCGCCTCGACCAGAACCCGCTCGCCGTGCCCCC
CAAGGAGGTGGTGGCCGGCGGCGTCGGCGCCGTCAAGGAGTACATGGCCAGGCGGTGGCG
CGACGCCCGCGCCGAGGAGGAGCGCCGGGGCAGCGCCGTCGCCGAGAGCCCCAGGGTGTC
GACGCCCAAGGAGTGGCTGGTGCGCAGCGTCTCGTCGCTGGGCAGCTGGGTGTCCGACGT
CACGAGGTACGGCGCCGGCCAGGACAAGGCAGCGGCGGAGGAGGAGGAGGACGCCTACCT
CCAGCAGAATCTGTGATCGGAGATTACAGCATTTGCTTGCTCCGGTGCTTTCATCCGTAT
GTACAGAAGAACTACTGCAGACCGTCGCCGCGTCGTTCGTTTCGCATCAGCCGTGTGTTT
GTGTGTGTTTACCTTCGCTGATTCCTTACCATTTACCATTTTTGTTGTTGTTGTTTTAAC
CGTTTTGCTGTTTAAAACTTTTAAACCCAGGTTACTGGACCACAGTGCCTGTGTGTTTG

CDS

1506 bp

>Os02t0593600-01 Leucine-rich repeat, typical subtype containing protein.
atggatccgacgccgcagtcgcacccgatcctggcgtacgtgctgtcgcggctcccgtcg
ctgctgccggtgtcgccgtcgctgtccaccccgcgcgcgcgGGACATCGAGcagccgtcc
ccgcgggcgccgtcgggcgccgcggagttcgacctcgtcagccgcatgccggggctccgc
cacccgtccgtcctctccgccatgacgcgcgccgtcgccgacgtctcctcggcgcgcgac
gcgctccgcctcctcggcccccgccccgaccacgagctcgtcgactccgcccgCGCCTTC
CTCCGCTCCCACGCCGCCGAAGAGGCCGAAGAGGAGGAGGAGGACGAGAAGGTGGCGAAG
AGCCGGGAGGTGGTGCGGCTGGACGAGGCGCACGAGTCGTACGGTGGCTTGCTGCGGGAG
GCGGAGGAGAGGCTGGATCGCGTGTACCGGACGGCGATGAGAGGGAGGGACATGCAGGTG
GTGGCCGCGGCGCACGGCGGTGGCGGGGAGGAGGAGGCCGGGGTGGTGGACGACGAGGTG
GTGCGGGTGCTCCGGGACGCGGAGGAAGGGAAGGCGGTGGAGCGCCTCCTCCTCGCCGAC
CGGCAGCTCCGCCACCTGCCCGAGCAGCTCGGCCGGATCCGCGGCCTCCTCGTCCTCGAC
GTCTCGCGAAATCAGCTCAAGAATGTCCCAGATGCCATAGGCGGGCTCGAACACCTGGAA
GAGCTTCGCCTCGCTTCCAACGCGTTGGTCTCCCTCCCGGACTCCATAGGCCTCCTCACC
AGCCTCAAGATCCTCGACGTCTCGGGCAACAAGCTGAGGTCTCTCCCCGACAGCATCTCA
AAATGCAGGTCGCTGGTGGAGCTGGACGTGAGCTACAACGTGCTGTCGTACCTCCCGACG
GGGATCGGGCAGGAGATGGCGAGGCTGGAGAAGCTGTGGGTGCACCTGAACAAGCTGCGG
TCGCTGCCGTCGTCGGTGTGCGAGATGCGGTCGCTGCGCCTCCTGGACGCGCACTTCAAC
CAGCTCCGGGGGCTCCCCGCGGGGATCGGGAGGCTGGCGGCGCTGGAGTCGCTCAACCTC
AGCAGCAACTTCAGCGACATGCGCGACCTCCCGGCGTCGTTCGGGGACCTGCTCGGCCTG
CGCGAGCTCGACCTCAGCAACAACCAGATACACGCGCTCCCGGACTGCTTCGGCCGCCTC
CAGCGCCTCGAGCGGCTCCGCCTCGACCAGAACCCGCTCGCCGTGCCCCCCAAGGAGGTG
GTGGCCGGCGGCGTCGGCGCCGTCAAGGAGTACATGGCCAGGCGGTGGCGCGACGCCCGC
GCCGAGGAGGAGCGCCGGGGCAGCGCCGTCGCCGAGAGCCCCAGGGTGTCGACGCCCAAG
GAGTGGCTGGTGCGCAGCGTCTCGTCGCTGGGCAGCTGGGTGTCCGACGTCACGAGGTAC
GGCGCCGGCCAGGACAAGGCAGCGGCGGAGGAGGAGGAGGACGCCTACCTCCAGCAGAAT
CTGTGA

Protein

502 aa

>Os02t0593600-01 Leucine-rich repeat, typical subtype containing protein.
MDPTPQSHPILAYVLSRLPSLLPVSPSLSTPRARDIEQPSPRAPSGAAEFDLVSRMPGLR
HPSVLSAMTRAVADVSSARDALRLLGPRPDHELVDSARAFLRSHAAEEAEEEEEDEKVAK
SREVVRLDEAHESYGGLLREAEERLDRVYRTAMRGRDMQVVAAAHGGGGEEEAGVVDDEV
VRVLRDAEEGKAVERLLLADRQLRHLPEQLGRIRGLLVLDVSRNQLKNVPDAIGGLEHLE
ELRLASNALVSLPDSIGLLTSLKILDVSGNKLRSLPDSISKCRSLVELDVSYNVLSYLPT
GIGQEMARLEKLWVHLNKLRSLPSSVCEMRSLRLLDAHFNQLRGLPAGIGRLAALESLNL
SSNFSDMRDLPASFGDLLGLRELDLSNNQIHALPDCFGRLQRLERLRLDQNPLAVPPKEV
VAGGVGAVKEYMARRWRDARAEEERRGSAVAESPRVSTPKEWLVRSVSSLGSWVSDVTRY
GAGQDKAAAEEEEDAYLQQNL*

5'UTR

chr02:22978830..22978959 (+ strand) : 130 bp

CDS

chr02:22978960..22979640 (+ strand) : 681 bp

chr02:22980272..22980438 (+ strand) : 167 bp

chr02:22980572..22981229 (+ strand) : 658 bp

3'UTR

chr02:22981230..22981452 (+ strand) : 223 bp

FASTA

>Os02t0593600-01 class=Sequence position=chr02:22978830..22981452 (+ strand)
TTCTTTTTCG CCACCCGATC CGGCAACAAC AACGTACGTA ACCTCCtctc tctctctctc tctctctccc cttccagccg
cgcgcgcgca cgcacgccgc cgtcgtgacg tcgccgtcgc ggtcgccgcc atggatccga cgccgcagtc gcacccgatc
ctggcgtacg tgctgtcgcg gctcccgtcg ctgctgccgg tgtcgccgtc gctgtccacc ccgcgcgcgc gGGACATCGA
Gcagccgtcc ccgcgggcgc cgtcgggcgc cgcggagttc gacctcgtca gccgcatgcc ggggctccgc cacccgtccg
tcctctccgc catgacgcgc gccgtcgccg acgtctcctc ggcgcgcgac gcgctccgcc tcctcggccc ccgccccgac
cacgagctcg tcgactccgc ccgCGCCTTC CTCCGCTCCC ACGCCGCCGA AGAGGCCGAA GAGGAGGAGG AGGACGAGAA
GGTGGCGAAG AGCCGGGAGG TGGTGCGGCT GGACGAGGCG CACGAGTCGT ACGGTGGCTT GCTGCGGGAG GCGGAGGAGA
GGCTGGATCG CGTGTACCGG ACGGCGATGA GAGGGAGGGA CATGCAGGTG GTGGCCGCGG CGCACGGCGG TGGCGGGGAG
GAGGAGGCCG GGGTGGTGGA CGACGAGGTG GTGCGGGTGC TCCGGGACGC GGAGGAAGGG AAGGCGGTGG AGCGCCTCCT
CCTCGCCGAC CGGCAGCTCC GCCACCTGCC CGAGCAGCTC GGCCGGATCC GCGGCCTCCT CGTCCTCGAC GTCTCGCGAA
ATCAGCTCAA GGTATTATTA ATTGCTGATT TGTTTCTGTC ATTTTCTGTG GTTATCGATC GCCAACCTGC AAAACCTGCA
TTGCGTTGCG CGGTTGCGTT CGCGGATCAC GAGTTCACGT CGTTTCAGAT TTAGAAATTA GAAGAACTGT TCGTCCGATC
CGGGGAATTC GGGTGATAGG GAGATTTGTT ATGTTTTGCA TTTCTCGGGT AGTTTTTCAG TCCAGAAATG CAGATCGTAT
AAGACATTGC AGATGTGCAT GCCCCAAAAA TAATGGATGA CGGGTAGAAC GCAATGCTGG TTAATTAAAA TTGTCACTGA
AAGCAATCCA CTTATGAGTT AGGTTTATGA GAATTGTTTT TGCATTTTTT TTTTAAGATC ACGCATGTTT ATTTTTGATA
TCATGATTAT TGAACACGAA TGAATTATGA GCATAGAGGA GTCAAATATG GTATAAAAAA GAAATCATTT TCTTCCAACT
ACGAAATTGC GCAATATGCT AGTAAAACTG AATGTGGTGA TGTGGTCCAT TCAAGAATTT CTGGTTTACA GGCTACAGTC
CCACAAAGCT AGAAAACACT GTAAAGTTCA GTTTTATTTT CTTTCCATCT GTTAGTACTA GCTATTTTCA TTGAATTTGC
AGAATGTCCC AGATGCCATA GGCGGGCTCG AACACCTGGA AGAGCTTCGC CTCGCTTCCA ACGCGTTGGT CTCCCTCCCG
GACTCCATAG GCCTCCTCAC CAGCCTCAAG ATCCTCGACG TCTCGGGCAA CAAGCTGAGG TCTCTCCCCG ACAGCATCTC
AAAATGCAGG TAGAATCAAC CAGCCAAGGC CAAAGCACGC ATCATCATCA TCTTCTTCTT CTCCCCAATG GCATCCAGAT
CCAGTTAAAG AAACTTCAAT TCTCGCTAAT GGTGATCATC ACAAAATGAT CCAAACGTAC AGGTCGCTGG TGGAGCTGGA
CGTGAGCTAC AACGTGCTGT CGTACCTCCC GACGGGGATC GGGCAGGAGA TGGCGAGGCT GGAGAAGCTG TGGGTGCACC
TGAACAAGCT GCGGTCGCTG CCGTCGTCGG TGTGCGAGAT GCGGTCGCTG CGCCTCCTGG ACGCGCACTT CAACCAGCTC
CGGGGGCTCC CCGCGGGGAT CGGGAGGCTG GCGGCGCTGG AGTCGCTCAA CCTCAGCAGC AACTTCAGCG ACATGCGCGA
CCTCCCGGCG TCGTTCGGGG ACCTGCTCGG CCTGCGCGAG CTCGACCTCA GCAACAACCA GATACACGCG CTCCCGGACT
GCTTCGGCCG CCTCCAGCGC CTCGAGCGGC TCCGCCTCGA CCAGAACCCG CTCGCCGTGC CCCCCAAGGA GGTGGTGGCC
GGCGGCGTCG GCGCCGTCAA GGAGTACATG GCCAGGCGGT GGCGCGACGC CCGCGCCGAG GAGGAGCGCC GGGGCAGCGC
CGTCGCCGAG AGCCCCAGGG TGTCGACGCC CAAGGAGTGG CTGGTGCGCA GCGTCTCGTC GCTGGGCAGC TGGGTGTCCG
ACGTCACGAG GTACGGCGCC GGCCAGGACA AGGCAGCGGC GGAGGAGGAG GAGGACGCCT ACCTCCAGCA GAATCTGTGA
TCGGAGATTA CAGCATTTGC TTGCTCCGGT GCTTTCATCC GTATGTACAG AAGAACTACT GCAGACCGTC GCCGCGTCGT
TCGTTTCGCA TCAGCCGTGT GTTTGTGTGT GTTTACCTTC GCTGATTCCT TACCATTTAC CATTTTTGTT GTTGTTGTTT
TAACCGTTTT GCTGTTTAAA ACTTTTAAAC CCAGGTTACT GGACCACAGT GCCTGTGTGT TTG

Locus: Os02g0593600

Loading...

Locus: Os02g0593600

Loading...