Os02t0606700-01

Locus

Os02g0606700

Description

D-box containing protein, Regulation of the cell cycle, Maintenance of meristematic activity under stress conditions

RAP-DB Gene Symbol Synonym(s)

RSS1

RAP-DB Gene Name Synonym(s)

rice salt sensitive 1

CGSNL Gene Symbol

RSS1

CGSNL Gene Name

RICE SALT SENSITIVE 1

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK063512

AB753859

Protein Evidence

Q6K1Z8

Literature

PMID: 23041461

PMID: 21505434

Note

Manual Curation

February 27, 2018

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytosol (GO:0005829)

Full-length cDNA

001-116-G03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0606700-01)

RiceXPro (AK063512)

Others

Oryzabase (10273)

KEGG (Os02t0606700-01)

Transcript

1336 bp

>Os02t0606700-01 D-box containing protein, Regulation of the cell cycle, Maintenance of meristematic activity under stress conditions
AAAGCAAAAAAATTTCCCCTTTCCTCTCCACGCCAAGAAACGCAAAACCCCCACGCCGAC
CAAGGCGAGAAGCGCCGCCGCCGAATCGAACCGCGATCGCGCCCTTCTCCCGCCGCCCCC
GCGCGCTCTTCTCCTCCTCGTCCTCGACGCCGCTGTGCCGGAGTTTAGGCGGAGATCGAT
CCGGAGCGGGGTTTCTCTTCTACCTGGTAGGCAAGGTTGAGGAAGAAAAGCTTGCTGATT
TGTGATGGCTGCCCCAACTGCAACAGCTGTTTTTCTTGATGAGAACCTGCATATCCATAG
GGGGCCTGCTGGCAAGAGGGCTGATGGATTGAAGGCCAAGCCACTGAAGCCATTAGCAGC
AAAGCAAGGGCTTCAAGAGAAGAAGGCCCTGAGGGATGTATCCAACATTGGCAAGCCCCC
GGTGTCTACGCGGAAGCCCCTGCAGGACGTGTCCAACACCGCCAAGCCCCGAGGGCGCAA
CATTTCTGATGGCACTACCTTGAAGAAGACTGCTCTTCGCAGCCATGAGGCCACCAAGAA
CCCAGTGAAGAAGACTGTAATCTTTTCTGATGAGACCGCAAAATGTCATGAATGGGCTAA
GGATGGGGTGGAGGGCACCCACTTCACTGGGAATGATTCTCAGAAGTTGGAAAAGGACAG
TCAAGACAAACGTGTCAAGAAGAAGGTGGAGAAAATAATGTCAGCATTGCACGACTGGCC
AGACGCGGTATTTGATCATGTGCTTTTTCCATCTGAGGTGGTAGCAGCGTTTTTTGAAGA
AGTAAAAGAGATGGAGCTGGAACCTGAGATTCTTCCAGAGAACAATAGGCGTCGCTCAAG
TTCAGGTGATAAAATGAAGCTGGCTGAAGATCCTTTCACGGAAGACGAGCTTGACTACTA
CCCATTTCTTGAGAACAATCCCGTTGAGTTTCAGCTGAGAGATGAGCTACCACTCCTGGA
GCCTGGAATGAACTGAAGAATGCTAATCTGCCCCACTTGAAAAGACCTCAGAACAGTGCT
ATTATCATCATTATCCTCTTTGCAAACTCTACTTGCTCAGGAGCAGTTTATTTGTAGTAG
TAGTAGTAGTAACTAGTATCCTAGATGTTCTGCTGTATGTGGTTGGTGTGATAATCATTC
ACACTTTAGGAAGAACCCAAGTAGCGGAAGCAACTTTAGCTTCCTTTATGTTCTGTGTCT
TGGCTGAAATACCCATCATTAAGCCATTGTGTAAATGGTAGTAGTAGTAAACTGTAGTGT
AAGGATTCTGCAGAAGTACATGCGTGTGCCACTTCCTCTATTACGAATGCGTGCACATGT
GTTTGATTTCCTGTTT

CDS

732 bp

>Os02t0606700-01 D-box containing protein, Regulation of the cell cycle, Maintenance of meristematic activity under stress conditions
ATGGCTGCCCCAACTGCAACAGCTGTTTTTCTTGATGAGAACCTGCATATCCATAGGGGG
CCTGCTGGCAAGAGGGCTGATGGATTGAAGGCCAAGCCACTGAAGCCATTAGCAGCAAAG
CAAGGGCTTCAAGAGAAGAAGGCCCTGAGGGATGTATCCAACATTGGCAAGCCCCCGGTG
TCTACGCGGAAGCCCCTGCAGGACGTGTCCAACACCGCCAAGCCCCGAGGGCGCAACATT
TCTGATGGCACTACCTTGAAGAAGACTGCTCTTCGCAGCCATGAGGCCACCAAGAACCCA
GTGAAGAAGACTGTAATCTTTTCTGATGAGACCGCAAAATGTCATGAATGGGCTAAGGAT
GGGGTGGAGGGCACCCACTTCACTGGGAATGATTCTCAGAAGTTGGAAAAGGACAGTCAA
GACAAACGTGTCAAGAAGAAGGTGGAGAAAATAATGTCAGCATTGCACGACTGGCCAGAC
GCGGTATTTGATCATGTGCTTTTTCCATCTGAGGTGGTAGCAGCGTTTTTTGAAGAAGTA
AAAGAGATGGAGCTGGAACCTGAGATTCTTCCAGAGAACAATAGGCGTCGCTCAAGTTCA
GGTGATAAAATGAAGCTGGCTGAAGATCCTTTCACGGAAGACGAGCTTGACTACTACCCA
TTTCTTGAGAACAATCCCGTTGAGTTTCAGCTGAGAGATGAGCTACCACTCCTGGAGCCT
GGAATGAACTGA

Protein

244 aa

>Os02t0606700-01 D-box containing protein, Regulation of the cell cycle, Maintenance of meristematic activity under stress conditions
MAAPTATAVFLDENLHIHRGPAGKRADGLKAKPLKPLAAKQGLQEKKALRDVSNIGKPPV
STRKPLQDVSNTAKPRGRNISDGTTLKKTALRSHEATKNPVKKTVIFSDETAKCHEWAKD
GVEGTHFTGNDSQKLEKDSQDKRVKKKVEKIMSALHDWPDAVFDHVLFPSEVVAAFFEEV
KEMELEPEILPENNRRRSSSGDKMKLAEDPFTEDELDYYPFLENNPVEFQLRDELPLLEP
GMN*

5'UTR

chr02:23769400..23769609 (+ strand) : 210 bp

chr02:23770369..23770402 (+ strand) : 34 bp

CDS

chr02:23770403..23770460 (+ strand) : 58 bp

chr02:23770545..23770913 (+ strand) : 369 bp

chr02:23771017..23771102 (+ strand) : 86 bp

chr02:23772094..23772181 (+ strand) : 88 bp

chr02:23772303..23772433 (+ strand) : 131 bp

3'UTR

chr02:23772434..23772793 (+ strand) : 360 bp

FASTA

>Os02t0606700-01 class=Sequence position=chr02:23769400..23772793 (+ strand)
AAAGCAAAAA AATTTCCCCT TTCCTCTCCA CGCCAAGAAA CGCAAAACCC CCACGCCGAC CAAGGCGAGA AGCGCCGCCG
CCGAATCGAA CCGCGATCGC GCCCTTCTCC CGCCGCCCCC GCGCGCTCTT CTCCTCCTCG TCCTCGACGC CGCTGTGCCG
GAGTTTAGGC GGAGATCGAT CCGGAGCGGG GTTTCTCTTC TACCTGGTAG GTAAGCACTG GGGCTTTCTC TTGGATTGGT
CACGCGTTGT CTTGAATTTT TTTTTCCCGT CATCGAGGAA AATTTTGCCC TATCTTGCTC GTTTCTTGGT TGTTGGTGAC
CGAATCCAAA CCCTAGGTTA TCCGCAACAT TCCGGTCCAA TTCGTGCAAA CTGGCATGTT ATTGGGGATT TGTTTGCTCC
TGCTAATTTC ATGAAATACG TATGGCTCGG GTCCCTTGGA AGATTTTAGG TGCGTCGTCT AATCTGTTAG TTTGGAACCC
GGAGCAAAAT ATTTCTGAGC TGTCGCTGCA AATCTGTTGG AGAAACGGCT GTGTCCCTTG AAGACTCTAG GTGCGCCGTC
TAATCTGTta cttcctccgt ttcacaatat aagtcattct agtatttccc acattcatat tgatactaat gaatctagat
agatatagtc tagatccatt ggcatcaata tgaatgtggg aaatggtgga atgacttaca ttatgaaacg gagggagtaG
TTTAGAACGC AAAGCAAAAT ATTTCTGATA TTTTGCTGAA AATCTGTTGG AGAAATGGGG ACTCATGCAG AATGTATGTG
AAATCCTGGT TTCCTTCAGC AACCATATGT TGTTATGCTA CAAGTTGAAC TAATATTTTT CTGACCATGT GCAAAATTTG
TAGAACAAAA TGTGTAATAT ATACTGCTTA TTGTTTTTCT CTAGCAATTT TGTCTTTTCC CCCTTTGCTC AGTACCTAGA
ATTTTTCAGG CAAGGTTGAG GAAGAAAAGC TTGCTGATTT GTGATGGCTG CCCCAACTGC AACAGCTGTT TTTCTTGATG
AGAACCTGCA TATCCATAGG GGTAAGGCTG CTTTTGATCT GACTAATTCA TCACAAGGAG GATTTCCTGT GGTAAATGAC
TGACATGTTT GGTCCATGTG TGCAGGGCCT GCTGGCAAGA GGGCTGATGG ATTGAAGGCC AAGCCACTGA AGCCATTAGC
AGCAAAGCAA GGGCTTCAAG AGAAGAAGGC CCTGAGGGAT GTATCCAACA TTGGCAAGCC CCCGGTGTCT ACGCGGAAGC
CCCTGCAGGA CGTGTCCAAC ACCGCCAAGC CCCGAGGGCG CAACATTTCT GATGGCACTA CCTTGAAGAA GACTGCTCTT
CGCAGCCATG AGGCCACCAA GAACCCAGTG AAGAAGACTG TAATCTTTTC TGATGAGACC GCAAAATGTC ATGAATGGGC
TAAGGATGGG GTGGAGGGCA CCCACTTCAC TGGGAATGAT TCTCAGAAGT TGGAAAAGGA CAGTCAAGAC AAACGTAAGA
GTTCACTTCC TGCAGTTCAA TATGCCATAG AACCCTTTTG CTTTCAGTAG GCTCAGATAA TGAGATAACT TGTTTTGTTA
TTGTTCATTC TACACAGGTG TCAAGAAGAA GGTGGAGAAA ATAATGTCAG CATTGCACGA CTGGCCAGAC GCGGTATTTG
ATCATGTGCT TTTTCCATCT GAGGTATGTA TTTCAAAGAG CACAGTGTTC AGACTTTTCC AGATTGCTTT TACTTTTGAA
ATATTTCTGT GGATTTGAAT TTCAAGGTCG AAGAAGAAAG CTTTTGATTT TTTCTATGTA CAAATACACT ACCTAACTTG
GCTAACTAGC TTGGCTGATA ATTTATTGAA TCTAGAAGAG CCTCAAGTAT TGCTTGATCT CTACATACCT TTTGCGTGAA
CAGTAGCTGA TGCCTGGTGG TATCATTTGA CACAAGAAGA TAACTAATGG GTACATAGTA AATTAATGAC TAGGCCAGTA
TTTTATGTTT TCTGTCGCAA AACAATAGTG GTGGTATCAT TTGACAAGCT TATTCTTGTT ATTTTATCTG TCATTTGACA
AGCTTAATTG GGCTATTTCC CTGTAATATT CTCTTATATT AAGAGAAAAA AAAGTCTATT CTGAATTATA CTATTCCCTG
AATGAAACTG TTATCTGGAT ATTGATGGAT TCCCTTTTGC TACCAGTAGT GCTTGTCTTT ATTTATTTCC AAGCTGGCTG
ACTTATTTCA TTGTGGTTCC TCTATTTATA TTTATGCTTA ATAATAGTAT TCACTGGCAT CAGAAGAAGC CAGAAAGGGG
ACTTCTATGA TTCGGTATGA CATTGGTTTC GCTAAAAGTT AACTCATGGA TGAGAAAACC TTACATGTAT TTTAATAGCT
AACAACAGAG AACATCCATG ATACCGTCAT GGGTCAGTAA CAGTTAAAAT GTTTGATGGT TATTAATTGT GGTATGTTCT
TCTGTCTGTA CATGGTTCTG TTTGATGAAC TGCTCGGTCA TTCATTCATG CTCTGAAGTC TGAAGCAACA TGTTATTCTA
GGGATAAATT ATGTCTTGCT CTATGTCGAT AACATTTCTT GCTTTCTTGT ATCTTTTCTT CTTGATCTCC AATATGTTAT
GTGATTATCT CAAGCAACGC AGATGCAATG CTAATTGTTT TTCAATGTAT ATAGGTGGTA GCAGCGTTTT TTGAAGAAGT
AAAAGAGATG GAGCTGGAAC CTGAGATTCT TCCAGAGAAC AATAGGCGTC GCTCAAGTTC AGGTCTCTTT CTTCTTCCTT
GCACACATTC ATGCCGTTCT CTCATCTCTG CTTTCCAGTG CTTCCATCAA CAACATCGTC TCGATTTCTT CCTTATAATC
TGTATGGATG TTTGCCCCTC CAGGTGATAA AATGAAGCTG GCTGAAGATC CTTTCACGGA AGACGAGCTT GACTACTACC
CATTTCTTGA GAACAATCCC GTTGAGTTTC AGCTGAGAGA TGAGCTACCA CTCCTGGAGC CTGGAATGAA CTGAAGAATG
CTAATCTGCC CCACTTGAAA AGACCTCAGA ACAGTGCTAT TATCATCATT ATCCTCTTTG CAAACTCTAC TTGCTCAGGA
GCAGTTTATT TGTAGTAGTA GTAGTAGTAA CTAGTATCCT AGATGTTCTG CTGTATGTGG TTGGTGTGAT AATCATTCAC
ACTTTAGGAA GAACCCAAGT AGCGGAAGCA ACTTTAGCTT CCTTTATGTT CTGTGTCTTG GCTGAAATAC CCATCATTAA
GCCATTGTGT AAATGGTAGT AGTAGTAAAC TGTAGTGTAA GGATTCTGCA GAAGTACATG CGTGTGCCAC TTCCTCTATT
ACGAATGCGT GCACATGTGT TTGATTTCCT GTTT

Locus: Os02g0606700

Loading...

Locus: Os02g0606700

Loading...