Os02t0611800-01

Locus

Os02g0611800

Description

Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HCT2

CGSNL Gene Name

HYDROXYCINNAMOYLTRANSFERASE 2

Oryzabase Gene Symbol Synonym(s)

OsHCT2, HCT

Oryzabase Gene Name Synonym(s)

Hydroxycinnamoyltransferase 2, hydroxycinnamoyl CoA:shikimate/quinate hydroxycinnamoyl transferase 2

Transcript Evidence

AK060705 (DDBJ, Best hit)

AK104319 (DDBJ, Best hit)

Protein Evidence

Q7XXP1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Full-length cDNA

001-030-G09 (Online Clone Ordering)

001-025-E04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0611800-01)

Others

Oryzabase (10357)

Transcript

1716 bp

>Os02t0611800-01 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
AGCTCTCCCCCAAGAGCTGCTTACCTAACATACTTTTACAACTCCACCATTGTCCATTGC
CAAAGGCCTTCGATCTCGCCTCCCAGATCTGCCCCGCGTCGGCGAAGATGAAGATCAACG
TGCGGGGGTCGACGATGGTGCGGCCGGCGGAGGAGACGCCGCGGGTGAGGCTGTGGAACT
CTAGCCTGGACCTGGTGGTGCCGCGGTTCCACACGCCGAGCGTCTACTTCTTCCGGCGCG
GCGAGGCGGCGGCGGCGGAGGGCGGGAGCTACTTCGACGGGGAGAGGATGCGGCGGGCGC
TGGCGGAGGCGCTGGTTCCGTTCTACCCGATGGCGGGGCGGCTGGCGCACGACGAGGACG
GCCGCGTGGAGATCGACTGCAACGGGGAAGGCGTGCTGTTCGTCGAGGCCGACGCGCCGG
GCGCCACCGTCGACGACTTCGGCGACTTCGCGCCCACCATGGACCTCAAGCGCCTCATCC
CCACCGTCGACTACACCGACGGCATCTCCTCCTTCCCCATCCTCGTGCTCCAGGTGACCC
ACTTCAAGTGCGGAGGCGTCGCCCTCGGCGTGGGCATGCAGCACCACGTCGCCGACGGCT
TCTCCGGCCTGCACTTCATCAACTCGTGGGCGGACCTCTGCCGCGGCGTCCCGATCGCCG
TCATGCCGTTCATCGACCGCACCCTCGTCCGCGCCCGCGACCCGCCGGCGCCGTCGCACC
CGCACGTCGAGTACCAGCCGGCGCCCGCCATGCTGGCCCCCGAGCCGCCGCAGGCGCTGA
CCGCCAAGCCGGCGCCGCCGCCCACCGCCGTGGACATCTTCAAGCTGTCCCGCTCCGACC
TCGGCCGCCTCCGGTCCCAGCTGCCCCGCGGCGAGGGCGCGCCGCGGTACAGCACGTACG
CGGTGCTCGCGGCGCACGTGTGGCGGTGCGCGTCGCTGGCGCGGGGGCTCCCCGCGGAGC
AGCCCACCAAGCTGTACTGCGCCACGGACGGACGCCAGCGGCTGCAGCCGTCGCTGCCCG
ACGGCTACTTCGGCAACGTGATCTTCACGGCGACGCCGCTCGCCGAGGCCGGGAGGGTGA
CCGGGTCGCTGGCGGACGGCGCGGCGACGATCCAGTCGGCGCTGGACAGGATGGACAGCG
GCTACTGCCGGTCGGCGCTGGACTACCTGGAGCTGCAGCCCGACCTGTCGGCGCTGGTCC
GCGGCGCGCACACGTTCCGGTGCCCCAACCTCGGCCTCACCAGCTGGGTCCGACTGCCGA
TCCACGACGCCGACTTCGGCTGGGGGCGGCCGGTGTTCATGGGCCCCGGCGGCATCGCGT
ACGAGGGGCTCGCCTTCGTGCTCCCCAGCGCCAGCGGCGACGGCAGCCTGTCGGTGGCCA
TCTCGCTGCAGGCCGAGCACATGGAGAAGTTCCGCAAGATGATCTTCGACTTCTGATCCT
CTGAAATCAAACAACACGTACGTACGCACGCACGAACGCGCACATGCATGGAGAGGAGGC
GGGGTGGTTCTTAACACAGCCTATCATCGGTAGGATGCAGCAACGATTCTTTGATTCCAC
ACGTTAGTTCCTGCAAATTTTTCCCTTCCTGCCTTCCCGCTTTTGGGCAGGACACATTTT
GTGCCAACTGTATTTGTATTGTGAACAGTTAATTAATCCGTAAACATTACGAAACACAGA
GGGTTAATAAGGTTAATCACGGTGGTTTACTTCGCC

CDS

1329 bp

>Os02t0611800-01 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
ATGAAGATCAACGTGCGGGGGTCGACGATGGTGCGGCCGGCGGAGGAGACGCCGCGGGTG
AGGCTGTGGAACTCTAGCCTGGACCTGGTGGTGCCGCGGTTCCACACGCCGAGCGTCTAC
TTCTTCCGGCGCGGCGAGGCGGCGGCGGCGGAGGGCGGGAGCTACTTCGACGGGGAGAGG
ATGCGGCGGGCGCTGGCGGAGGCGCTGGTTCCGTTCTACCCGATGGCGGGGCGGCTGGCG
CACGACGAGGACGGCCGCGTGGAGATCGACTGCAACGGGGAAGGCGTGCTGTTCGTCGAG
GCCGACGCGCCGGGCGCCACCGTCGACGACTTCGGCGACTTCGCGCCCACCATGGACCTC
AAGCGCCTCATCCCCACCGTCGACTACACCGACGGCATCTCCTCCTTCCCCATCCTCGTG
CTCCAGGTGACCCACTTCAAGTGCGGAGGCGTCGCCCTCGGCGTGGGCATGCAGCACCAC
GTCGCCGACGGCTTCTCCGGCCTGCACTTCATCAACTCGTGGGCGGACCTCTGCCGCGGC
GTCCCGATCGCCGTCATGCCGTTCATCGACCGCACCCTCGTCCGCGCCCGCGACCCGCCG
GCGCCGTCGCACCCGCACGTCGAGTACCAGCCGGCGCCCGCCATGCTGGCCCCCGAGCCG
CCGCAGGCGCTGACCGCCAAGCCGGCGCCGCCGCCCACCGCCGTGGACATCTTCAAGCTG
TCCCGCTCCGACCTCGGCCGCCTCCGGTCCCAGCTGCCCCGCGGCGAGGGCGCGCCGCGG
TACAGCACGTACGCGGTGCTCGCGGCGCACGTGTGGCGGTGCGCGTCGCTGGCGCGGGGG
CTCCCCGCGGAGCAGCCCACCAAGCTGTACTGCGCCACGGACGGACGCCAGCGGCTGCAG
CCGTCGCTGCCCGACGGCTACTTCGGCAACGTGATCTTCACGGCGACGCCGCTCGCCGAG
GCCGGGAGGGTGACCGGGTCGCTGGCGGACGGCGCGGCGACGATCCAGTCGGCGCTGGAC
AGGATGGACAGCGGCTACTGCCGGTCGGCGCTGGACTACCTGGAGCTGCAGCCCGACCTG
TCGGCGCTGGTCCGCGGCGCGCACACGTTCCGGTGCCCCAACCTCGGCCTCACCAGCTGG
GTCCGACTGCCGATCCACGACGCCGACTTCGGCTGGGGGCGGCCGGTGTTCATGGGCCCC
GGCGGCATCGCGTACGAGGGGCTCGCCTTCGTGCTCCCCAGCGCCAGCGGCGACGGCAGC
CTGTCGGTGGCCATCTCGCTGCAGGCCGAGCACATGGAGAAGTTCCGCAAGATGATCTTC
GACTTCTGA

Protein

443 aa

>Os02t0611800-01 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
MKINVRGSTMVRPAEETPRVRLWNSSLDLVVPRFHTPSVYFFRRGEAAAAEGGSYFDGER
MRRALAEALVPFYPMAGRLAHDEDGRVEIDCNGEGVLFVEADAPGATVDDFGDFAPTMDL
KRLIPTVDYTDGISSFPILVLQVTHFKCGGVALGVGMQHHVADGFSGLHFINSWADLCRG
VPIAVMPFIDRTLVRARDPPAPSHPHVEYQPAPAMLAPEPPQALTAKPAPPPTAVDIFKL
SRSDLGRLRSQLPRGEGAPRYSTYAVLAAHVWRCASLARGLPAEQPTKLYCATDGRQRLQ
PSLPDGYFGNVIFTATPLAEAGRVTGSLADGAATIQSALDRMDSGYCRSALDYLELQPDL
SALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASGDGS
LSVAISLQAEHMEKFRKMIFDF*

5'UTR

chr02:24080704..24080810 (+ strand) : 107 bp

CDS

chr02:24080936..24081361 (+ strand) : 426 bp

chr02:24083433..24084335 (+ strand) : 903 bp

3'UTR

chr02:24084336..24084615 (+ strand) : 280 bp

FASTA

>Os02t0611800-01 class=Sequence position=chr02:24080704..24084615 (+ strand)
AGCTCTCCCC CAAGAGCTGC TTACCTAACA TACTTTTACA ACTCCACCAT TGTCCATTGC CAAAGGCCTT CGATCTCGCC
TCCCAGATCT GCCCCGCGTC GGCGAAGGTT GGTTGGAATG CTCTCTGTTT TCATCTCGTT TGCTTGCTTG GATGTTTCTC
CCCGTTTGCT GGTTTGCCGG CGAGGTGTTC GACCGATTGA TTGGTTGATC GTGTTGCGTG CGATGCGAGC AGATGAAGAT
CAACGTGCGG GGGTCGACGA TGGTGCGGCC GGCGGAGGAG ACGCCGCGGG TGAGGCTGTG GAACTCTAGC CTGGACCTGG
TGGTGCCGCG GTTCCACACG CCGAGCGTCT ACTTCTTCCG GCGCGGCGAG GCGGCGGCGG CGGAGGGCGG GAGCTACTTC
GACGGGGAGA GGATGCGGCG GGCGCTGGCG GAGGCGCTGG TTCCGTTCTA CCCGATGGCG GGGCGGCTGG CGCACGACGA
GGACGGCCGC GTGGAGATCG ACTGCAACGG GGAAGGCGTG CTGTTCGTCG AGGCCGACGC GCCGGGCGCC ACCGTCGACG
ACTTCGGCGA CTTCGCGCCC ACCATGGACC TCAAGCGCCT CATCCCCACC GTCGACTACA CCGACGGCAT CTCCTCCTTC
CCCATCCTCG TGCTCCAGGT ATCCAATTCT CCTCCATTTT TTCTCCTCAC GCGTAGTAGG AATCTACTAT TCTATTTCTA
CCGCCACCAA CTCGATCGCT TGCCTGCGGG CGACGACCCG GTCAGCGCTC ATGCAATTCA ATTGCTAGGT GATTAGTGGC
TGGCTGCGTC ATGCCAACAA TTTTCTTTTC TTTTTTGGAC CCTATCAAGC TCTAGCTTAG ACCGAGTGAA GCCTCCATTC
ATGGTGCCAA ATTGCCGACC AACCTACCTA TGTGAATTAT CGAAACACGT ATGAATTTTT AGCATTTGTA GGCTTTTTTT
AATATAGGGA TTTTTCATTA ATTTATTCCT GGTATGAATC GAAAAGAAAA AAAATCATAC CTGTTGCAGA AAACATTTGT
TAGTACTGGA ATTTTCTATG GAAATGATTA GCTTTATTCC TTAGAAATTT CCTGGAATGG CCACATCAGC TCTCTGTTTT
TATAGGCCTT CTATTAATAC ATGTCTCATG TCAACGATTA TCTGAGTACG GTAATGACTA ATGATTGGCC TGCGCACAGT
TGAACCCTGT CATTAGATCC CATCAATTTG GAACATATGA ATTTAAAAGA TCTTTTGCGG GAAATTTAAA AGAAATTGTA
CAGCATGAAA ACAACCTAGC CGTGTAATTG TTTGGTTAGA ACCATATATT CTGACAGCTA GACAAGTCGA AAACTACCCT
GAGAATTGGG GAAGGTGTTC TACCTACTTG AGTCCGACTT CTCGCTGTTG TTGTGACTTG CGAGCTATCA TCGTTTCTTT
TGTCAAACAT GAAAGCGAAG TAGCGAACCA ATTGTTTGAT AAGATTGCCA GATCATATTT GTGCACAGCC TCACAATTGT
CACAACTGCT CCAGTTGGTA CATCATCAGC ATCCACATGG GTGACCCCCT GACCCGGTTG AGATAGAGTG AGCTTAAggg
tgtgttatag ttcctgaaaa aagttggaag tttgaagaaa gttaggagtt tgaaaaaaaa gttggaagtt tatgtgtgta
ggaaattttt ttatgtgata tgatgtgatg gaaatttggg aataggggga aactaaacac ggccTAACCA AACAACAAAA
TGTTAGTTAT TTGCTGGACA TCTTATTCTT CGGATGCACG ACACATGTTG GTTGAAAGAC AATGATGTAC CAGCTAGAAT
GTAAAAAATA AATGTTTCTT TGTCTTTGCT TTGTGCTAGC AAGCAAACCT TAATTTGATT GATCGTTCCA TATAgggggt
gtttagatgg ggctaaaact ttttagtacg tgtcacatcg aatgtttgga cgttaatttg aagtattaaa catagactaa
taaaaaaact aatttcataa atgagagcta atctgcgaga cgaaattttt aagcctaatt aatccataat tatgaaaagt
ttactgtagc atcacattgt caaatcatgg cgtaattaga ctcaaaatat tcgtctcgcg aattagtcca agattatgga
atgggttttg taattagtat atgtttaata ctctaaatta atatccaaat atccgatgtg acaggtaagt ccctgtttac
taaacaagcc cTTAGTCTGC CCTTAATCAG GTTCTCCAGC TGTATATTTT CTGTCTAGGC TCCATCTATG ATCCCATAAT
TGAGTTCAGG CAGGTAAGGT GGTCTGCAAC ATCCAAGTTG GCTTGCCATG ACCGAGACCT TGAGTATTAT TCTAAGCAAT
CATTCGCTCA TACGGAGTAC ACGTTTAGTG GGACAGAGGA AGTACGTTGA GATACAAGAG GTCAAATGAA TTGCTTCTAG
ACGATTGGAA TTTAATATGG TAACGTTAGT TGAACTAGAG GTATCTTAGT GAAACGGTAG GTGCAATAAA GAAGTTGTGT
TTTCCCTTAA GCACATGGTG CTGTGTGATC TCGTCCTTTT TTTTTTCCAC TCTAATAATG CTCAGGAGAT TAAAGAAGTC
TCGGTCACGT ATAACTCTGT AAAAAGAATT TTGTAATCTT TGTGAAAGAA CAGAGCGGTT AGTTAAACTT TGGCGCCATT
TTGCTCCAGG TGACCCACTT CAAGTGCGGA GGCGTCGCCC TCGGCGTGGG CATGCAGCAC CACGTCGCCG ACGGCTTCTC
CGGCCTGCAC TTCATCAACT CGTGGGCGGA CCTCTGCCGC GGCGTCCCGA TCGCCGTCAT GCCGTTCATC GACCGCACCC
TCGTCCGCGC CCGCGACCCG CCGGCGCCGT CGCACCCGCA CGTCGAGTAC CAGCCGGCGC CCGCCATGCT GGCCCCCGAG
CCGCCGCAGG CGCTGACCGC CAAGCCGGCG CCGCCGCCCA CCGCCGTGGA CATCTTCAAG CTGTCCCGCT CCGACCTCGG
CCGCCTCCGG TCCCAGCTGC CCCGCGGCGA GGGCGCGCCG CGGTACAGCA CGTACGCGGT GCTCGCGGCG CACGTGTGGC
GGTGCGCGTC GCTGGCGCGG GGGCTCCCCG CGGAGCAGCC CACCAAGCTG TACTGCGCCA CGGACGGACG CCAGCGGCTG
CAGCCGTCGC TGCCCGACGG CTACTTCGGC AACGTGATCT TCACGGCGAC GCCGCTCGCC GAGGCCGGGA GGGTGACCGG
GTCGCTGGCG GACGGCGCGG CGACGATCCA GTCGGCGCTG GACAGGATGG ACAGCGGCTA CTGCCGGTCG GCGCTGGACT
ACCTGGAGCT GCAGCCCGAC CTGTCGGCGC TGGTCCGCGG CGCGCACACG TTCCGGTGCC CCAACCTCGG CCTCACCAGC
TGGGTCCGAC TGCCGATCCA CGACGCCGAC TTCGGCTGGG GGCGGCCGGT GTTCATGGGC CCCGGCGGCA TCGCGTACGA
GGGGCTCGCC TTCGTGCTCC CCAGCGCCAG CGGCGACGGC AGCCTGTCGG TGGCCATCTC GCTGCAGGCC GAGCACATGG
AGAAGTTCCG CAAGATGATC TTCGACTTCT GATCCTCTGA AATCAAACAA CACGTACGTA CGCACGCACG AACGCGCACA
TGCATGGAGA GGAGGCGGGG TGGTTCTTAA CACAGCCTAT CATCGGTAGG ATGCAGCAAC GATTCTTTGA TTCCACACGT
TAGTTCCTGC AAATTTTTCC CTTCCTGCCT TCCCGCTTTT GGGCAGGACA CATTTTGTGC CAACTGTATT TGTATTGTGA
ACAGTTAATT AATCCGTAAA CATTACGAAA CACAGAGGGT TAATAAGGTT AATCACGGTG GTTTACTTCG CC

Locus: Os02g0611800

Loading...

Locus: Os02g0611800

Loading...