Os02t0621100-01

Locus

Os02g0621100

Description

Similar to Su(VAR)3-9-related protein 4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET10, SDG712

Oryzabase Gene Name Synonym(s)

SET protein 10

Transcript Evidence

AK100391 (DDBJ, Best hit)

Protein Evidence

B8AFI2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Functional domain (InterPro)

SET domain (IPR001214)

Pre-SET domain (IPR007728)

WIYLD domain (IPR018848)

Full-length cDNA

J023086A12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0621100-01)

RiceXPro (AK100391)

Others

Oryzabase (13376)

KEGG (Os02t0621100-01)

Transcript

2750 bp

>Os02t0621100-01 Similar to Su(VAR)3-9-related protein 4.
GCAGGTGGCGCCTCTAATTCCTCCTCCTCGCGCCCTAGTCCCCTCGCCTTCCCCTCCCGT
CTCCTCGCCCGCCGGCCGCCGCCTGCGACGATCCCCATCCCGCGAGCGGCAGCGGTGCCG
GCGGTCCTCTGCCGCACCCTCGCCGCGGTGAGCTCCCGGTCAGCAGTTTCCACATCTCAG
CTAAGGACTGGAATGGCCAAACCCAATGGCAAAGAGAAAACGGGTGACACGGGATTGTCG
ATGGCTCCTCCAAAGATTTCCAAGGATAGATTTGATGCTGCTATCAGAGCCATGGCTGAT
ATTGGTATCCTAAAGGAAACTGCTGCGCCCGTGTTGAATAATCTACTAAACTTATTCGAT
TACAACTGGGTGCATATAGAAGCTGATAATTATCTGGCTCTTGCTGATGCTATATTTTGT
GATTCAGATCCCAAAGAAGGACAGAAAAGGCAAGCTAATGAGACAAATCTTGATGCAGAC
CAATCTAACAAGAAGCTTAAGACAAAAAAGCGTTCTCAAAATCCTACATCCAAGATGCAT
GGCAATGACAATAGAGAGTTTGTTGAAGCTCCACCACAGCAGGGACGAGGCACACTGTCT
GCCCGAACTGTTAATGGGAAGAAAGTCACCAGGGCCCACTTGGAGTTGCCTTCTTCACAA
TTACTGATCAAGGAACCACATACATGCCCTAGCATTGCAAAGAATACAACAATTGTTGAA
AATAATTCTGCTGTATTATGCCATGGTCAAGACCTTCAAACTTTTGAGGTCCCAGTAGCA
ACTACTTGTCCGCAAGTTGTAGCCCCCAGTACTCGCAAAGATGCACGTAGGACTTCTGGT
GCTCGCCATGATCAGAAGCATGAAGGTGTATCTGGTGCGCATGAAAGGAACAGGGCTGTT
GCGTGTAGCAACCAGGAAATTGTAAGCAGCAAGGATTCTCCATCCAACATTGAGGTAGTT
TTGTCAAATTATGGAGCTGGGAAACTATCATTCACATACAACTCTTCCCTGGCAAACCGT
TCTGATTTTCATCTGCCTGACATTAAATTAATTTGCAAGAAAATGGAGGCTAGATGCCTT
AGGAAATACAAGAGCCTAGAACCCAATTTCTCTTTTAAGAATCTTATTAAAGATACTTGC
CAGTGTATTGTTGAATCTAGTGGACCTAGACATGAAGGCATCATACAAACTGTTCCTGCC
CTGGACATTCTGTCCAAACCTTCAGTGCCGCAAATATTGCAGTCAAATCAAGCTAATTCC
GCTTTTATGCCACCTAATAATGTCATGAGCCTTGGTGGTACTTCTTCCTCTTGCACTGTT
GCTGGAGTTAGCCAGAATTCTAGTAATATGCCGGTTGTTCCGCATCAACTACATATTGGT
GCCAACAGACCACCTCATGATGTCAATGATATCACAAAAGGTGAAGAACGTTTAAGGATT
CCAATTATTAATGAATATGGCAATGGGATTCTTCCTCCTCCATTTCACTACATACCACAC
AATATCACACTCCAAGAAGCCTATGTAAACATCTCCCTTGCTAGAATCGGAGATGACAAT
TGCTGTTCTGATTGTTTCAGAGATTGTCTGGCACAATCACTTCCTTGTGCGTGTGCTGCA
GAAACAGGAGGAGAGTTTGCTTATACAACAGATGGCCTTCTTAAGGGAGCATTTCTAGAT
AGCTGTATCTCAATGATTCGAGAACCACTTAAACATCCCCATTTCTACTGCAAGATTTGC
CCAAACGAACGAATGAAGATAGAAGTAAATTCTGATTCATCAAACACAGAAATGAATCCT
GGTCCTTGTAAAGGACACCTTACAAGGAAATTCATCAAGGAGTGCTGGAGAAAATGCGGC
TGCACTAGAAATTGTGGAAACCGTGTGGTGCAGCGAGGCATCACACGCCATTTACAGGTG
TTCTTAACCCCTGAAAAAAAAGGATGGGGATTGCGCAGTACTGAGAAACTTCCTCGAGGT
GCTTTTGTTTGTGAGTATGTTGGTGAAATATTAACGAACATTGAGTTGTATGACCGTACA
ATTCAAAAGACTGGTAAAGCAAAGCACACATACCCATTGTTACTTGATGCCGACTGGGGT
ACTGAAGGTGTTCTTAAGGATGAGGAAGCCCTTTGTCTAGATGCCACGTTTTATGGTAAC
GTCGCAAGATTTATAAACCACAGGTGCTTTGATGCTAATATTATAGGAATACCTGTTGAG
ATCGAGACGCCCGACCACCATTATTACCATCTGGCGTTCTTCACAACAAGGATAATAGAG
CCTTTTGAGGAACTCACATGGGACTATGGGATTGATTTTGATGATGTCGACCATCCTGTG
AAGGCATTCAAATGTCATTGCGGAAGTGAGTTTTGCCGAGACAAAACGCGCAGATCTAAA
TCGAGGGCGCGGGTTTAACCTATGAATTCTCTACTCTGCTATTCAAGTGATTCAAGGAAG
TCAATGCAGAGCCATTGATGGTATCGTCCAGAAAGATGATATAGTAATTTTTCTCTGGAA
TAGGATAAACAATCCAGATTCCAGAGTTACAGACTGCTGGTTCAGCACTTAAATATTCCA
ACAGCTCATACGAACTGCTGTCCTTTTTTTCCAAGCTTGGTTGCCCGCAAAGCAGTATGC
TTGGTTGCCCGTTCTTTGTTCCTTTTACCAATACCAAGTGATGTAAAGAATTCTGGAATG
TGAACTCTCTGCCATGATATAGCTCTAGCTCAATGCATTATATTGGGGAA

CDS

2226 bp

>Os02t0621100-01 Similar to Su(VAR)3-9-related protein 4.
ATGGCCAAACCCAATGGCAAAGAGAAAACGGGTGACACGGGATTGTCGATGGCTCCTCCA
AAGATTTCCAAGGATAGATTTGATGCTGCTATCAGAGCCATGGCTGATATTGGTATCCTA
AAGGAAACTGCTGCGCCCGTGTTGAATAATCTACTAAACTTATTCGATTACAACTGGGTG
CATATAGAAGCTGATAATTATCTGGCTCTTGCTGATGCTATATTTTGTGATTCAGATCCC
AAAGAAGGACAGAAAAGGCAAGCTAATGAGACAAATCTTGATGCAGACCAATCTAACAAG
AAGCTTAAGACAAAAAAGCGTTCTCAAAATCCTACATCCAAGATGCATGGCAATGACAAT
AGAGAGTTTGTTGAAGCTCCACCACAGCAGGGACGAGGCACACTGTCTGCCCGAACTGTT
AATGGGAAGAAAGTCACCAGGGCCCACTTGGAGTTGCCTTCTTCACAATTACTGATCAAG
GAACCACATACATGCCCTAGCATTGCAAAGAATACAACAATTGTTGAAAATAATTCTGCT
GTATTATGCCATGGTCAAGACCTTCAAACTTTTGAGGTCCCAGTAGCAACTACTTGTCCG
CAAGTTGTAGCCCCCAGTACTCGCAAAGATGCACGTAGGACTTCTGGTGCTCGCCATGAT
CAGAAGCATGAAGGTGTATCTGGTGCGCATGAAAGGAACAGGGCTGTTGCGTGTAGCAAC
CAGGAAATTGTAAGCAGCAAGGATTCTCCATCCAACATTGAGGTAGTTTTGTCAAATTAT
GGAGCTGGGAAACTATCATTCACATACAACTCTTCCCTGGCAAACCGTTCTGATTTTCAT
CTGCCTGACATTAAATTAATTTGCAAGAAAATGGAGGCTAGATGCCTTAGGAAATACAAG
AGCCTAGAACCCAATTTCTCTTTTAAGAATCTTATTAAAGATACTTGCCAGTGTATTGTT
GAATCTAGTGGACCTAGACATGAAGGCATCATACAAACTGTTCCTGCCCTGGACATTCTG
TCCAAACCTTCAGTGCCGCAAATATTGCAGTCAAATCAAGCTAATTCCGCTTTTATGCCA
CCTAATAATGTCATGAGCCTTGGTGGTACTTCTTCCTCTTGCACTGTTGCTGGAGTTAGC
CAGAATTCTAGTAATATGCCGGTTGTTCCGCATCAACTACATATTGGTGCCAACAGACCA
CCTCATGATGTCAATGATATCACAAAAGGTGAAGAACGTTTAAGGATTCCAATTATTAAT
GAATATGGCAATGGGATTCTTCCTCCTCCATTTCACTACATACCACACAATATCACACTC
CAAGAAGCCTATGTAAACATCTCCCTTGCTAGAATCGGAGATGACAATTGCTGTTCTGAT
TGTTTCAGAGATTGTCTGGCACAATCACTTCCTTGTGCGTGTGCTGCAGAAACAGGAGGA
GAGTTTGCTTATACAACAGATGGCCTTCTTAAGGGAGCATTTCTAGATAGCTGTATCTCA
ATGATTCGAGAACCACTTAAACATCCCCATTTCTACTGCAAGATTTGCCCAAACGAACGA
ATGAAGATAGAAGTAAATTCTGATTCATCAAACACAGAAATGAATCCTGGTCCTTGTAAA
GGACACCTTACAAGGAAATTCATCAAGGAGTGCTGGAGAAAATGCGGCTGCACTAGAAAT
TGTGGAAACCGTGTGGTGCAGCGAGGCATCACACGCCATTTACAGGTGTTCTTAACCCCT
GAAAAAAAAGGATGGGGATTGCGCAGTACTGAGAAACTTCCTCGAGGTGCTTTTGTTTGT
GAGTATGTTGGTGAAATATTAACGAACATTGAGTTGTATGACCGTACAATTCAAAAGACT
GGTAAAGCAAAGCACACATACCCATTGTTACTTGATGCCGACTGGGGTACTGAAGGTGTT
CTTAAGGATGAGGAAGCCCTTTGTCTAGATGCCACGTTTTATGGTAACGTCGCAAGATTT
ATAAACCACAGGTGCTTTGATGCTAATATTATAGGAATACCTGTTGAGATCGAGACGCCC
GACCACCATTATTACCATCTGGCGTTCTTCACAACAAGGATAATAGAGCCTTTTGAGGAA
CTCACATGGGACTATGGGATTGATTTTGATGATGTCGACCATCCTGTGAAGGCATTCAAA
TGTCATTGCGGAAGTGAGTTTTGCCGAGACAAAACGCGCAGATCTAAATCGAGGGCGCGG
GTTTAA

Protein

742 aa

>Os02t0621100-01 Similar to Su(VAR)3-9-related protein 4.
MAKPNGKEKTGDTGLSMAPPKISKDRFDAAIRAMADIGILKETAAPVLNNLLNLFDYNWV
HIEADNYLALADAIFCDSDPKEGQKRQANETNLDADQSNKKLKTKKRSQNPTSKMHGNDN
REFVEAPPQQGRGTLSARTVNGKKVTRAHLELPSSQLLIKEPHTCPSIAKNTTIVENNSA
VLCHGQDLQTFEVPVATTCPQVVAPSTRKDARRTSGARHDQKHEGVSGAHERNRAVACSN
QEIVSSKDSPSNIEVVLSNYGAGKLSFTYNSSLANRSDFHLPDIKLICKKMEARCLRKYK
SLEPNFSFKNLIKDTCQCIVESSGPRHEGIIQTVPALDILSKPSVPQILQSNQANSAFMP
PNNVMSLGGTSSSCTVAGVSQNSSNMPVVPHQLHIGANRPPHDVNDITKGEERLRIPIIN
EYGNGILPPPFHYIPHNITLQEAYVNISLARIGDDNCCSDCFRDCLAQSLPCACAAETGG
EFAYTTDGLLKGAFLDSCISMIREPLKHPHFYCKICPNERMKIEVNSDSSNTEMNPGPCK
GHLTRKFIKECWRKCGCTRNCGNRVVQRGITRHLQVFLTPEKKGWGLRSTEKLPRGAFVC
EYVGEILTNIELYDRTIQKTGKAKHTYPLLLDADWGTEGVLKDEEALCLDATFYGNVARF
INHRCFDANIIGIPVEIETPDHHYYHLAFFTTRIIEPFEELTWDYGIDFDDVDHPVKAFK
CHCGSEFCRDKTRRSKSRARV*

5'UTR

chr02:24708074..24708230 (+ strand) : 157 bp

chr02:24710823..24710857 (+ strand) : 35 bp

CDS

chr02:24710858..24710904 (+ strand) : 47 bp

chr02:24711690..24711885 (+ strand) : 196 bp

chr02:24712039..24712423 (+ strand) : 385 bp

chr02:24713939..24715035 (+ strand) : 1097 bp

chr02:24715228..24715493 (+ strand) : 266 bp

chr02:24716172..24716238 (+ strand) : 67 bp

chr02:24716329..24716379 (+ strand) : 51 bp

chr02:24716640..24716730 (+ strand) : 91 bp

chr02:24716927..24716952 (+ strand) : 26 bp

3'UTR

chr02:24716953..24717284 (+ strand) : 332 bp

FASTA

>Os02t0621100-01 class=Sequence position=chr02:24708074..24717284 (+ strand)
GCAGGTGGCG CCTCTAATTC CTCCTCCTCG CGCCCTAGTC CCCTCGCCTT CCCCTCCCGT CTCCTCGCCC GCCGGCCGCC
GCCTGCGACG ATCCCCATCC CGCGAGCGGC AGCGGTGCCG GCGGTCCTCT GCCGCACCCT CGCCGCGGTG AGCTCCCGTA
CGCGCACATC CTCATCCTCC TCATCCCTCT CTATACGCAC CTCTTTCTCT GAAGCAAATT GGGGTTTTGG CCGGGTGGGA
CATGCACCAT GCACCACGTT AGGTCCGCCC CTGTTGTGAT GCGGGGTGAG GGCTCCTCGT ATGAGGGTTT TTCTTCGGCC
TATTTCTGCG AAGTTTCGAT GTCCTCCCGC GTTGCTTGGG TGTGCGAATG TGATCGCTCC GAGGTTGAGG AGCTTTGCTC
GTATTGTATT TTGGGTGCCT GTTCAGTCGC TTTGAGTTGC TCGTTTGTTG CTCTGATCAC AATAAGGCTG CTTCTCCTGC
TTAGTTTTCT TGTGTGAAAA TTTGTGAGAT CTGGGCGTGC CTTTGGCACT ATTGCCCCCA AATCCACCAT TGTGCCGACT
TGTGAGCTTC CTGTTCGGGA GTTGGAGGCG TTCTATGTGA AGAATTAGAT GCATGCAACA TTGAGTACTT GTTCAAAAGG
TCATAATATA TCAGAATGCA GCCTTGGGTA TTTGTTCAAA AGGCTAGATT CTATATACTT CCTCCgtcag aaaatatagc
tacttctcca cttactccct catctcaacc atccctcatt taatttctgc atctactttc ccatctcaac caatcacaac
catccctaat gtaatttaac ccctcttctt aatgtccggg aaaaactcca aaagtgtttt ttttttggaa tACACGAGGA
GCGTATCTTT GTATTAAGAA GGAATAAATG TATGTATAAA GCGGGCCAAA AAGACAAAAC GAAGGGGACA GGGTACAGGA
GGAGAACAAA AAACTAAAAG CCTAATCTCC AACTAAATTT TTGCGACCCT TCTCCACTAA CATGGGCTAC CAAAACAGGG
ATTGCAGCTC TTGCTAGCCG CCACAGCTCC GCTTCACCCG TCATAACCCT TGCAACCTCC ACCCAAGTTC TGCTCTTCTG
GTTGAAGACT CGATTGTTTC TTTCCTTCCA GATCGTCCAT GCAACCAATG TTGCGATGGT GTCGAAACCC CGGCGATGTT
CCTTGACCAT CTTCTTATGA CAGTCACACA ACCATGAAAA GAAAGAGTGT TAATGAGCGG TAAGCACTCC GAATGCCCGA
TAGCTTTGAA TGCAACCCAC CATAGTTGCC GCGATTCCGG GCATTCgacc aagagatgat caatcgtctc ttcgcattga
tcacaaagaa cacatcgatc cgggtgtgac aaaccacgac tcgggaggcg gtccgctatc cagcaacggt taagggtgac
caaccaaagg aagtagcgac agcgaggggg cgccTGTTTA TATTTTTTTT GACAGAGGGA GTATTATATA AGTTAGTGAA
GGTTAAATGG AGCCAACATA TTTGCTCTCA AGGCCTAGAA ATTACCATGT TAATGAGGTA AAAAAAGAGA AAGATATATG
CCACTAGTCA TGGTTGGTCT AGATTATAGC TATGTAGATT GAAAATAGAA GAAAGAATAT ATATATATAT ATATATATAT
AATAAATTAT ATATTCAAAT AAGCTTTAAT GGAGTTGCGC ATAGTTTGGG TGGGAAATTT GACCAGATAT CAAATGTTTT
ATTAAAGAAA ATGATTGCAT GGGAAATATT GAAATATATT TCCATAGGTT TGTAGCTACG ATTTTCCCAC TTTTTTTTTG
CTGAAGCCTT TTTAAGCAAC TGTTTGGATT AACTCAGTCA AATGCAGCAG GATATAATAT AGCTAGGGCA GAAATGGCAT
TCTTATGTTT CAGAACCACA ATAGACTTGG TGATGTGAGT GATCTAGATA GGACTGCGAC TTCCTTCCAT GACAATTGCA
ATGGGATATT TGTAGTATCA AATGGGTGGA TTCACCCATG TAAAGTTTTA GACTGGATTT CAAAACCAAT ATTCAATACC
GATCGGATAG TACTGCAATT TCCTGCGTTT Gttagtcaca aagttcccgg gtcgacggga ttgaggaacg gggtcgagaa
acgtggtatg ctacttgtga gaggttttta caaggtgggc acgaaaatga ccccgcgttc ccttaacggg gatggcgttc
ccgggtctag gattcgctgc cactgacccc gtttccagtg actaaTATGA TCTGAAATTG ATTTTACTTT GTTTGTATTC
AATATGTTAA TTAAGAAGGG AATTTATATC TTTTTTGAGG AAATCCTATC CTCTACAAAC CAGATTTATA TGTTTTTGAA
CTTGTTCGTC CATTGTGAAC AAGGTAAACC ACTTGCCCAT ATTATTAGTC TTATCAACTC GACACTATGG CTTACATTAT
AACTATATTT AGTAAATGAT CATTATACAC CTATTTATGG ACTACTGCAA TTCAAAAAGA GATTATTACT ACTGTAGCTT
GAACAGTTCT CTGAACAGAA AGTACTGTTC AAATAACCTA AAAGTGCCAA TTTCTGACAC AGTTTTATAG CATGATTTCC
TTATGATGTT TGTTTTTGCT ACTGCATTCT GATGGCAGAG AAACATGAAC AATTGAGCTA AAGGTTATAT GTATTCTGCT
TCTGTTCACG GACACTATTG TATTTGCAGG GTCAGCAGTT TCCACATCTC AGCTAAGGAC TGGAATGGCC AAACCCAATG
GCAAAGAGAA AACGGGTGAC ACGGGATTGT CGTAAGAGTT ATTCTTTTAC TCAGCATTTT TTAATACAAT TGTTTTTATG
GGCATCCGAT GATATTATCC GATTCCAAAC TCTATCTCAC TCAGCAAAAA AAAAATAATT CACGAATATA TGACATGTCT
TGCACACTCA GAATTCTTAT ACTAAACCAT AGACACATCT TACAGAACAT TACTGCCTCA TGTAACACTG AACAAGGTAT
ACATTTCTGA ATGCTGCTCA AGTTGTCTAA CTTTGCATGC ACATGGAGAG ATAATAATGC AGATTGGATG TCAGCTGCTC
AAGTAGTATG AATTACTCAT TTTCTGTTTT TCCTGTTGTT GCACTGCTGT GTCATGAAAA CTAGTCACTT CCCCTGGCAT
ATATAaccat tctggttata gtgctatttg ttaagtttat tcctcaaaat atttaatttt ttcctataat caagtagatg
gtatgtggca attatccggt gagtaatctA TTTCAAATGC TGACTGAAAG AATAATATTA ACATGCACAA TAGATTGAAA
ATTCAGCAAT AAGCACAGCC CTTCTCCAAG GATAAATAAG TTAGCTTGTA CCTGGAGTAC TCTTGTGGTT GGTCCTGTAG
CCTAGTGTGC TTAGTCCACA ACTTCTCGTA ATGTATCACA ATCTTAACTT CATTGTACAT TCGTAAGATG TTTGTGATAC
CATGCTTAGT ATGTGTATAT GGTTTTTCTT ATCACTTGCT TTCTCAAAGG ATATCACGTG TTAATGTGCC ATGCTGATTT
GTTCCACTGC AAGCAGGATG GCTCCTCCAA AGATTTCCAA GGATAGATTT GATGCTGCTA TCAGAGCCAT GGCTGATATT
GGTATCCTAA AGGAAACTGC TGCGCCCGTG TTGAATAATC TACTAAACTT ATTCGATTAC AACTGGGTGC ATATAGAAGC
TGATAATTAT CTGGCTCTTG CTGATGCTAT ATTTTGTGAT TCAGATCCCA AAGTATAATC TTTTTGCTTT GTTCTGGCAT
ATTATTAAAT ATTTGGTTCT TTAAGTCAGT AGTGTAGTTT TATTCTTTAT TATGTGAGCA CCATATATCT TATTATTTCA
TTAATCTGCC ATTTTGATTT GATTCAAGTT TTGGTGATGT ACCAGGAAGG ACAGAAAAGG CAAGCTAATG AGACAAATCT
TGATGCAGAC CAATCTAACA AGAAGCTTAA GACAAAAAAG CGTTCTCAAA ATCCTACATC CAAGATGCAT GGCAATGACA
ATAGAGAGTT TGTTGAAGCT CCACCACAGC AGGGACGAGG CACACTGTCT GCCCGAACTG TTAATGGGAA GAAAGTCACC
AGGGCCCACT TGGAGTTGCC TTCTTCACAA TTACTGATCA AGGAACCACA TACATGCCCT AGCATTGCAA AGAATACAAC
AATTGTTGAA AATAATTCTG CTGTATTATG CCATGGTCAA GACCTTCAAA CTTTTGAGGT CCCAGTAGCA ACTACTTGTC
CGCAAGTTGT AGCCCCCAGT ACTCGCAAAG GTAATATCTT TGTAGGCGAC ATAGTGTTAA TAATTTATAT GAAAATGCTA
ACCTTTTAAT GCTTTGTTGA TGGATTCCCA CAAATTAATC TAGTTTTATT GTATAAACTA AAACATACAG GTCGCCCAGC
CTATTAATGT TGTCTACCTG AGTGTGCTAA TCTAAATATT CTTCTCTCCA CTCTATCCGT TCCAAAACAT CTTTTGGGCG
TGGTGCGGTA ACAACATTTT GAAATTTGAC AAATGTATCT AAATCAGCTG CATAAAAGCA ATATTAGTGT GTCCATCATC
AATTTACTTT CATAATGCTG TTAATTCATA GACCATCCAA AATTAATGAC TACTTATTGT TGGGAATTCA TGGAGTAAGT
TTAATTGTTG GGTTGTATTG TTGTCAACTT CAGTGCTATT TTATCAATTT GTTAACATTA TGTTAATATA GTCTTGGTCT
GTTAATCAGC TTCCTACCTA CACATCACTG TAGCGTTTTT TTTTTAAAAA AAAGATGAAT TACTTATGGT TTAGAGTTGA
AAGGAATACT TTATATAAAT TCCAGTTAAT GGGGTGTTGA GGCTTTGAGA GCAAGCGTGT ATTGTAAAGC ATTTTGCTAG
ACATGAGTGC ATTATTATTT AAAGAGAATT TTTTACTACT ACTTTCACAA TAAGAATCAT GATCCTCAAA CTTGGATTTG
AAAAAGACCC GTTATTTAAG TAATATTTCT GTGGGATTTT GTGGTCACTC CTTTTGAACT AGGGTTGTCA ATATATCCAA
AAGTAAAACT AATATTGATA TTCAGATGGC CTCCTTCGGC CTTCCCGGCG AAAAAAACTA ATATTGATAT AATGTTGTTG
CCAATATATT GCGATCAGAG AAGTTGTGAA AATCTTGCAT TGTGACTATT AACTTAAAGA CCATTTATAT TTGGCCAGAG
ATTATTTCGA ATTGTGTTGT CAATTTTGGT CAAAGAGTGG ACGTATACCT CTATAATGGT ATATATATAG AGAGAGAGTA
AGTTCACATA GTTATCTGAA ATTGTTGCTT AGAAGTGTGA TTTTTATAGT TTTGTGAAAG GTAGTGTTGT TTTTGTGGAA
TTTATTCACA TATCGTATAC ACTTTTTGCA AAAAGAAAAA AAAACATGTG GCTGTTTTTT GGATATATAG AATTTTATGT
GTGGATGTCT GAGGGATTAT GATCTTATGT CTGTTATTTT GGGGGATGGG GCAGGGAGGT CTAGAGCTCT GGATGTTGAT
ATCTCCTGGC AAAGAATTGG TCTAGAATTT GATCTCTAAT AACTGTACAA ATGTCAGTCC TTTAAATCCC TGTTCTACTC
TGTTGCGAGC ATGCTTGTCT AGTGATACTG AACAATATTG GAGTATTCTA GAGATGTCCT TTGCTTCCTG CAGAAAGTGT
CATTGTTGTT GCTGTCATGT TTATATTCTT TTTTTGGCTT GTTGCTAGCT CTTTACTTCA TTTCTAATCA AGTCTTTTGG
ATTTTCTATT TTTCACGTTA TGAAGATGCA CGTAGGACTT CTGGTGCTCG CCATGATCAG AAGCATGAAG GTGTATCTGG
TGCGCATGAA AGGAACAGGG CTGTTGCGTG TAGCAACCAG GAAATTGTAA GCAGCAAGGA TTCTCCATCC AACATTGAGG
TAGTTTTGTC AAATTATGGA GCTGGGAAAC TATCATTCAC ATACAACTCT TCCCTGGCAA ACCGTTCTGA TTTTCATCTG
CCTGACATTA AATTAATTTG CAAGAAAATG GAGGCTAGAT GCCTTAGGAA ATACAAGAGC CTAGAACCCA ATTTCTCTTT
TAAGAATCTT ATTAAAGATA CTTGCCAGTG TATTGTTGAA TCTAGTGGAC CTAGACATGA AGGCATCATA CAAACTGTTC
CTGCCCTGGA CATTCTGTCC AAACCTTCAG TGCCGCAAAT ATTGCAGTCA AATCAAGCTA ATTCCGCTTT TATGCCACCT
AATAATGTCA TGAGCCTTGG TGGTACTTCT TCCTCTTGCA CTGTTGCTGG AGTTAGCCAG AATTCTAGTA ATATGCCGGT
TGTTCCGCAT CAACTACATA TTGGTGCCAA CAGACCACCT CATGATGTCA ATGATATCAC AAAAGGTGAA GAACGTTTAA
GGATTCCAAT TATTAATGAA TATGGCAATG GGATTCTTCC TCCTCCATTT CACTACATAC CACACAATAT CACACTCCAA
GAAGCCTATG TAAACATCTC CCTTGCTAGA ATCGGAGATG ACAATTGCTG TTCTGATTGT TTCAGAGATT GTCTGGCACA
ATCACTTCCT TGTGCGTGTG CTGCAGAAAC AGGAGGAGAG TTTGCTTATA CAACAGATGG CCTTCTTAAG GGAGCATTTC
TAGATAGCTG TATCTCAATG ATTCGAGAAC CACTTAAACA TCCCCATTTC TACTGCAAGA TTTGCCCAAA CGAACGAATG
AAGATAGAAG TAAATTCTGA TTCATCAAAC ACAGAAATGA ATCCTGGTCC TTGTAAAGGA CACCTTACAA GGAAATTCAT
CAAGGAGTGC TGGAGAAAAT GCGGCTGCAC TAGAAATTGT GGAAACCGTG TGGTGCAGCG AGGCATCACA CGCCATTTAC
AGGTAAGTAA TAATATCAAA GTTTTTGCTA GCTTGACGAT AATTTGTCAA CTGCCAAATA TTGTTGAAAT TATGATGTTA
GCTGCAGCAG TTTGTTGTGA TAGTGCATCA TGTGTATGAT CATGTGCTTG TCACAGTAAA CATCTCATTG CTTACGTGTT
TTAATAATTT TTCTTGTTCT TTCTAAAATT TCAGGTGTTC TTAACCCCTG AAAAAAAAGG ATGGGGATTG CGCAGTACTG
AGAAACTTCC TCGAGGTGCT TTTGTTTGTG AGTATGTTGG TGAAATATTA ACGAACATTG AGTTGTATGA CCGTACAATT
CAAAAGACTG GTAAAGCAAA GCACACATAC CCATTGTTAC TTGATGCCGA CTGGGGTACT GAAGGTGTTC TTAAGGATGA
GGAAGCCCTT TGTCTAGATG CCACGTTTTA TGGTAACGTC GCAAGATTTA TAAACCACAG GTATCCATTT ATTATTTATA
ATAATGGATT CTTTTTTTAC CAGAACGTCT AATGATTGTT ATGGAGTCCT CTGTAATACA TGAAGCTGTT GCTTCTATGG
GATGGGTAAA AAAAGGGATG AGCTGGTTCT TGTCGCTTTC TGGTTTTCCC AGTGAGAACC TGGTGATGTA CATTTTCTGA
CTGTTCTGCG ATTTAGTGAG TTCTCCATGA TATGTGTGCT TCAAGTTGAA AGTGTAGGAA ATTTCATTGA AAATTGACAA
TTGGTGTGAC TGGTAAATGG CTACCAGTGG GGTCCCAACT AAAACCTCAT GGACCATAGC GTTTAACCCT GGTTCTGTGA
ACTAACTTAA TATGTGCTTT TCAGTTGTCA TTATATGATA TTTCTCGTTA CAAAACTGTG AACAACATCG TAGATTTGTG
ATTGTTTGGC TGCACCTATA TTATTGCCTG ATGTCGTAGA TTAGTGATTG TTTGGCTGCA ACCTATATTA TTGCCTGATG
TCAGCACTTA ATCAAGATAG TTAAGTCAAT GTTACTCTTA TTTGAAGCTA GCTAACAGAA CAAAGTCTTA TCCAAATTTT
GAATATATAA GTATTTCTTA AAAAAATGTT GCTTCTGTGC TCTGCTGAAT CTAACACTTC TTCCTTCTTG ACCTGGCATA
TCATTGTACG GTTTTCAGGT GCTTTGATGC TAATATTATA GGAATACCTG TTGAGATCGA GACGCCCGAC CACCATTATT
ACCATGTATT TTTTCAACTT TAGCTTGTAA CTGATATATA TTAGTCCAAG TTAAACCATA TTGAGCTTAT TCTGTGTCTT
CCATTTTTTG GTTAGCTGGC GTTCTTCACA ACAAGGATAA TAGAGCCTTT TGAGGAACTC ACATGGGTAG GTTGTACTCC
ACAATTTAAA TTTAAGCTCC ATTTCATGTG GACTATAACC ATTTTCAGAC ATTCTAGTTG AATTTGCTTT CATCTTATGT
TTTGGGCTTT TTGACCTTTT GGTGGCCACC TTGTGACTTG ATACTCATTA GTGCTTTTCC CATAGATAGT ATCCCCCCTT
TGTTTGGTTG AATCATGTAG CATATGGAGC ACTACCTGTT GTAAGTCATT TTTCGAAGTT TGCCATGATC TTGTGTTTAC
CTGCAGGACT ATGGGATTGA TTTTGATGAT GTCGACCATC CTGTGAAGGC ATTCAAATGT CATTGCGGAA GTGAGTTTTG
CCGAGACAAA ACGCGCAGTA AGTTCCTGAT GGCATCTATA TGTGCATTTA GGAAGTTGAG GTTCTCCCCT AAAATATGGC
TTTATTAATG CTGATTCTGT GAGGCATTTA CCTTGTGTCT CCATATGTAT AGATGAGTGG TTCTATGCTG CTGCACTCGT
CTGGTTCATC AATGAAATTG CATTAGCTGA CAAAAGTTTA TATACTGCCA CAGGATCTAA ATCGAGGGCG CGGGTTTAAC
CTATGAATTC TCTACTCTGC TATTCAAGTG ATTCAAGGAA GTCAATGCAG AGCCATTGAT GGTATCGTCC AGAAAGATGA
TATAGTAATT TTTCTCTGGA ATAGGATAAA CAATCCAGAT TCCAGAGTTA CAGACTGCTG GTTCAGCACT TAAATATTCC
AACAGCTCAT ACGAACTGCT GTCCTTTTTT TCCAAGCTTG GTTGCCCGCA AAGCAGTATG CTTGGTTGCC CGTTCTTTGT
TCCTTTTACC AATACCAAGT GATGTAAAGA ATTCTGGAAT GTGAACTCTC TGCCATGATA TAGCTCTAGC TCAATGCATT
ATATTGGGGA A

Locus: Os02g0621100

Loading...

Locus: Os02g0621100

Loading...