Os02t0622100-01

Locus

Os02g0622100

Description

Casein kinase I, Low temperature tolerance, Root development, Hormone sensitivity

RAP-DB Gene Symbol Synonym(s)

HBD2, OsCKI1, CKI, hbd2, CKI1, LTG1, OsCKI1/LTRPK1

RAP-DB Gene Name Synonym(s)

HYBRID BREAKDOWN 2, hybrid breakdown 2, rice casein Kinase I, casein kinase I, Low Temperature Growth 1

CGSNL Gene Symbol

HBD2

CGSNL Gene Name

HYBRID BREAKDOWN 2

Oryzabase Gene Symbol Synonym(s)

OsCKI1, CKI, hbd2, CKI1, LTG1, OsCKI1/LTRPK1, LTRPK1, OsLTRPK1

Oryzabase Gene Name Synonym(s)

hybrid breakdown 2, rice casein Kinase I, casein kinase I, Low Temperature Growth 1, low-temperature response protein kinase 1

Transcript Evidence

AK101388

AJ487966 (Zhonghua 11)

Protein Evidence

Q6K9N1

Q70YQ4 (Zhonghua 11)

Literature

PMID: 24635058

PMID: 14535884

Note

Manual Curation

January 28, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J033036G08 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0622100-01)

Others

Oryzabase (3121)

KEGG (Os02t0622100-01 (EC:2.7.11.1))

Transcript

2402 bp

>Os02t0622100-01 Casein kinase I, Low temperature tolerance, Root development, Hormone sensitivity
GGGGTACCCATAATCTCCACATCCTCCTCCTCCCACCTCTACTCCGGCCACCGGCCGCCT
CCTCCCACGCTCCCCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCATCGCCACCCGCCTCC
TCCTTCTAGCAGTAGTAATAAAGGAAGGAAGAAAATCCACCGCCCTACCCCTATCTATCC
GTTGCCTCACGTCCGTTTCCCACATTTTCCGCTTCCTTCGTCCATCGCCATCTATTAACC
CGCCCCCCCACGATTCCTGCCGAGAAATTTCTCCCCCCCACAGAGAGGGAGGCGATCCCT
AGCCTCGTCCTGAATCTCGCGGCGCCGCCAATTCGATCTGCCCGCGCCGTCTCAGGGCGG
CGAATCTTGGGCTGGAGTCGGGGGGAGAGATCCGGGATCTTCCTTTTCTTGGGTGTTCCC
GGGACGCAAATCTTGCGGCCGCCGGGCAATGTGACTGGGGTTCTTGTGGGGGGTGAGGCG
ATTCGCGCGCGCATTCGGTGCTGAATCTTGCGGGGATGGAGCATGTGATCGGGGGGAAGT
TTAAGCTGGGGAGGAAGATTGGGAGCGGATCTTTTGGGGAGCTATACCTTGGTGTGAATA
TACAGAGCAGCGAGGAGGTAGCCATCAAGTTGGAATCTGTAAAATCAAGGCATCCTCAGC
TTCATTATGAGTCAAAACTATACATGCTTCTGCAGGGGGGAACTGGAATTCCTCATCTGA
AGTGGTTTGGAGTGGAGGGGGAGTACAATGTCATGGTTATCGATCTTCTTGGTCCAAGTT
TAGAGGACTTATTCAACTACTGCAACAGAAAGTTTTCTCTTAAAACAGTACTTATGCTTG
CTGATCAGATGATCAACAGGGTAGAGTACATGCACACTAGGGGGTTTCTACATCGTGATA
TCAAGCCAGACAACTTCCTTATGGGTTTAGGCCGCAAAGCAAGCCAGGTTTATGTCATCG
ACTATGGTCTTGCAAAGAAATACCGGGACCTCCAAACTCATAAGCATATACCTTACAGGG
AGAACAAAAATCTCACAGGAACAGCACGCTATGCTAGTGTAAACACCCATCTTGGAGTAG
AACAAAGCAGGAGAGATGATTTAGAGTCTCTGGGCTATGTGCTTATGTATTTCTTAAGAG
GAAGCCTTCCTTGGCAAGGTCTAAAAGCTGGCACAAAAAAACAGAAATATGACAAAATTA
GTGAAAAGAAAATGCTTACTCCAGTTGAGGTTCTCTGTAAATCTTATCCCACAGAGTTCA
TTTCATACTTCCATTACTGTCGATCTTTGCGATTTGAAGATAAACCAGACTACAGCTATT
TGAAGAGACTTTTCCGAGATCTATTCATCCGTGAAGGGTACCAGCTTGATTATATATTTG
ATTGGACGAAGCAAGGTTCAGAAAGTAACAGATTGCGATCAAGTGGAAGGACAAGTGGGT
TGGTGGGACCATCTGCAGAACGGACTGAACGAGCTGCAGCAAGACAGGATGTTCCTGACA
GATTCTCTGGTACAGTCGATCCATTTGCTAGAAGAACTGGCTCTGGTTCTGGCCATTACG
GAGAGCACACAAAGCACAGAAATATATTGGATTCATTACTTGCACCCAAGACGGCTGTTG
ATTTAGATAAAAGAAGGCCCACATCATCATCTCGTAATGGGAGCACATCAAGGAAGGCTC
TCTTGTCAAGCAGCAGACCAAGTTCTGGAGATCCCATTGATCCGAACCGCAGTAACCTAA
TTCCAACCAGCAGTGGCAGCAGTCGCCCATCAACTATGCAGAGGCTTCACCAGTCAACAG
GACTTGAGACCAGGTCCTCGCTTACCAAAACTGCAAGAAATGTCCATGATGATCCCACTT
TGAGGACCTTTGAACGCCTTTCAATCAGTGCTGACAGAAGGAAATAATGCTTCGAAGAGC
AAAAGATGTGAGTTGCTGCTCCAGTGAGGACACTGGGGATTCCTTCACACGATGATTACT
GATCAACAAGTAAAAACCATTCTGTGCTACAGATGATGCTGAGATATGCTTAAGAGTGAA
GTTTGCTTACTGAATCTTGGCGCAAAAGAAATGGTTAAAGAAATCATTTTACACGCCATT
CAGAAGAACCCGGACCAGCAACTGTGCTGGTCCAATTAATGCTGATGTTGATCAAATATT
TGTAGAAATGTTATTGAAATAAAGCAGTTCATTACTAGCAAAATATGTACTATCACGTAG
TATTTCCTTTGTGCACTGCAACTAGAACTTCTGCCACTCTGCCACTATACTCTTAAGATA
ATCAATATCCTTTTTTGCCTTAGTGCCCTTTAGATACTCCGTCACATTATTTCCTTAAAA
ACTTGGAGATCATGTAATCGTTATTAATATATCATACGATCAGATATCGTTATTCAACTA
GC

CDS

1392 bp

>Os02t0622100-01 Casein kinase I, Low temperature tolerance, Root development, Hormone sensitivity
ATGGAGCATGTGATCGGGGGGAAGTTTAAGCTGGGGAGGAAGATTGGGAGCGGATCTTTT
GGGGAGCTATACCTTGGTGTGAATATACAGAGCAGCGAGGAGGTAGCCATCAAGTTGGAA
TCTGTAAAATCAAGGCATCCTCAGCTTCATTATGAGTCAAAACTATACATGCTTCTGCAG
GGGGGAACTGGAATTCCTCATCTGAAGTGGTTTGGAGTGGAGGGGGAGTACAATGTCATG
GTTATCGATCTTCTTGGTCCAAGTTTAGAGGACTTATTCAACTACTGCAACAGAAAGTTT
TCTCTTAAAACAGTACTTATGCTTGCTGATCAGATGATCAACAGGGTAGAGTACATGCAC
ACTAGGGGGTTTCTACATCGTGATATCAAGCCAGACAACTTCCTTATGGGTTTAGGCCGC
AAAGCAAGCCAGGTTTATGTCATCGACTATGGTCTTGCAAAGAAATACCGGGACCTCCAA
ACTCATAAGCATATACCTTACAGGGAGAACAAAAATCTCACAGGAACAGCACGCTATGCT
AGTGTAAACACCCATCTTGGAGTAGAACAAAGCAGGAGAGATGATTTAGAGTCTCTGGGC
TATGTGCTTATGTATTTCTTAAGAGGAAGCCTTCCTTGGCAAGGTCTAAAAGCTGGCACA
AAAAAACAGAAATATGACAAAATTAGTGAAAAGAAAATGCTTACTCCAGTTGAGGTTCTC
TGTAAATCTTATCCCACAGAGTTCATTTCATACTTCCATTACTGTCGATCTTTGCGATTT
GAAGATAAACCAGACTACAGCTATTTGAAGAGACTTTTCCGAGATCTATTCATCCGTGAA
GGGTACCAGCTTGATTATATATTTGATTGGACGAAGCAAGGTTCAGAAAGTAACAGATTG
CGATCAAGTGGAAGGACAAGTGGGTTGGTGGGACCATCTGCAGAACGGACTGAACGAGCT
GCAGCAAGACAGGATGTTCCTGACAGATTCTCTGGTACAGTCGATCCATTTGCTAGAAGA
ACTGGCTCTGGTTCTGGCCATTACGGAGAGCACACAAAGCACAGAAATATATTGGATTCA
TTACTTGCACCCAAGACGGCTGTTGATTTAGATAAAAGAAGGCCCACATCATCATCTCGT
AATGGGAGCACATCAAGGAAGGCTCTCTTGTCAAGCAGCAGACCAAGTTCTGGAGATCCC
ATTGATCCGAACCGCAGTAACCTAATTCCAACCAGCAGTGGCAGCAGTCGCCCATCAACT
ATGCAGAGGCTTCACCAGTCAACAGGACTTGAGACCAGGTCCTCGCTTACCAAAACTGCA
AGAAATGTCCATGATGATCCCACTTTGAGGACCTTTGAACGCCTTTCAATCAGTGCTGAC
AGAAGGAAATAA

Protein

464 aa

>Os02t0622100-01 Casein kinase I, Low temperature tolerance, Root development, Hormone sensitivity
MEHVIGGKFKLGRKIGSGSFGELYLGVNIQSSEEVAIKLESVKSRHPQLHYESKLYMLLQ
GGTGIPHLKWFGVEGEYNVMVIDLLGPSLEDLFNYCNRKFSLKTVLMLADQMINRVEYMH
TRGFLHRDIKPDNFLMGLGRKASQVYVIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTPVEVL
CKSYPTEFISYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQLDYIFDWTKQGSESNRL
RSSGRTSGLVGPSAERTERAAARQDVPDRFSGTVDPFARRTGSGSGHYGEHTKHRNILDS
LLAPKTAVDLDKRRPTSSSRNGSTSRKALLSSSRPSSGDPIDPNRSNLIPTSSGSSRPST
MQRLHQSTGLETRSSLTKTARNVHDDPTLRTFERLSISADRRK*

5'UTR

chr02:24766809..24767323 (+ strand) : 515 bp

CDS

chr02:24767324..24767399 (+ strand) : 76 bp

chr02:24767532..24767572 (+ strand) : 41 bp

chr02:24768661..24768730 (+ strand) : 70 bp

chr02:24768804..24768952 (+ strand) : 149 bp

chr02:24769098..24769193 (+ strand) : 96 bp

chr02:24769820..24769890 (+ strand) : 71 bp

chr02:24770486..24770547 (+ strand) : 62 bp

chr02:24770782..24770845 (+ strand) : 64 bp

chr02:24770933..24771017 (+ strand) : 85 bp

chr02:24771122..24771248 (+ strand) : 127 bp

chr02:24771321..24771382 (+ strand) : 62 bp

chr02:24771470..24771530 (+ strand) : 61 bp

chr02:24771621..24771754 (+ strand) : 134 bp

chr02:24771962..24772255 (+ strand) : 294 bp

3'UTR

chr02:24772256..24772750 (+ strand) : 495 bp

FASTA

>Os02t0622100-01 class=Sequence position=chr02:24766809..24772750 (+ strand)
GGGGTACCCA TAATCTCCAC ATCCTCCTCC TCCCACCTCT ACTCCGGCCA CCGGCCGCCT CCTCCCACGC TCCCCCCGCC
GCCGCCGCCG CCGCCGCCGC CGCCATCGCC ACCCGCCTCC TCCTTCTAGC AGTAGTAATA AAGGAAGGAA GAAAATCCAC
CGCCCTACCC CTATCTATCC GTTGCCTCAC GTCCGTTTCC CACATTTTCC GCTTCCTTCG TCCATCGCCA TCTATTAACC
CGCCCCCCCA CGATTCCTGC CGAGAAATTT CTCCCCCCCA CAGAGAGGGA GGCGATCCCT AGCCTCGTCC TGAATCTCGC
GGCGCCGCCA ATTCGATCTG CCCGCGCCGT CTCAGGGCGG CGAATCTTGG GCTGGAGTCG GGGGGAGAGA TCCGGGATCT
TCCTTTTCTT GGGTGTTCCC GGGACGCAAA TCTTGCGGCC GCCGGGCAAT GTGACTGGGG TTCTTGTGGG GGGTGAGGCG
ATTCGCGCGC GCATTCGGTG CTGAATCTTG CGGGGATGGA GCATGTGATC GGGGGGAAGT TTAAGCTGGG GAGGAAGATT
GGGAGCGGAT CTTTTGGGGA GCTATACCTT GGTACGTTCC TCGTGGGGTT CTCGGATCTC TCGTCTATCG CCGCTCGTTG
CGAGGCACCG TTCGTTTTTC TTCTTCTTAC TGTTTACGCT GTTTGTGATG ATGTCGTTGA TTCATGGATT GTTTCGATTA
CAGGTGTGAA TATACAGAGC AGCGAGGAGG TAGCCATCAA GTTGGTATGT GAAGATGATT TCGTTTCTGA TATATAAGCC
TTTTCTTACG CCAATGTATA TATTGTAGTA ATTAGTATTG CATTGGTTTC TTTTGTGCTG ATGTTGTGAT GCGAATATGG
TTTGTTCTGC CCTCCTAGAA AAGATTAGAT CACCTGAGGT GTAACAGAGT TTGCATTGCT GCATGATCAG AAATTTGAAT
GAAGCTACAT GTATACGTCC TTGTGAAATC GTTGACATGA CCTCTTGCTT AGTATCATAC TCTTTCATAC AAGTAGAAAC
CAGGTCTTCT AAATTTTTTT GGTTCTCCGA CCTAACTGGT CTATTAGAGA TGTTCAGAAT TGGGAAGTAA GAAAAAAGAG
GTGAAGATTT TTCAGCTTCC AATTGGATCG TTGACATTAT TTAATTGCTT CATCTAGGTG ATGTGTGTGG TTTACGAGAG
CACTTATTCT GAAACATCTG TAAATAACAT GAGGCAGCCC ACCAACCCTT GTCATACTAT ATTATCTGCT CTTGTAACAT
TAGGACTCAG GGCAGCCGCC CGTGATTCTG TTCACATCCT GTAAGACCTG CAAACAAAGC TTTTCCGTCT GGGGAAACGA
AGCCTTTTGG AATACCTTGT GCATGTTTTG GCTAGGTTGG GTAGCTGTGA AGCATTGGTT ATTGTCTATT TCAATGTTTC
AAAGCAGCAT TCAAGGATTC TCCTGATATT ATTGCTCCGG TTCAGTGGTC AATGCACTTC TTTTAGAAGC TTCTATTATT
TCGATATGAT TGTTAGTAGT TTGGTCACAT CTACTTTTCA AGCAACTTAC CTTGTAAGTT CACGTAGTTG CTAGTTTTGT
GAACCAGCTT TGCCTTTCTA ATCATGAATG CCATTTCTAT ATTGTAAGCC TGTATGCATT GGATTGCTTT CTTAAATGGT
GCAATCCTTG TTCTATGAGA AAATGTTGGT AATAATGAAA ATAAGGTGTT CGGAAACTTG GAAAGTGTAT TTCTATATTG
ACATGAATAG TCACTGTCAG CACTGATTAC TTGTCCTTGC TGACACTGGG ACAAATTACC TAAACCTTTT CTGTCATCTC
TTATTTTGTT AGGAATCTGT AAAATCAAGG CATCCTCAGC TTCATTATGA GTCAAAACTA TACATGCTTC TGCAGGGGGG
AAGTAAGTGT AATACGGGAA ACTGTTTATC TATTTAAATA AAATTGTTCA CTTATTATGT CTTGGTTATG TTCAGCTGGA
ATTCCTCATC TGAAGTGGTT TGGAGTGGAG GGGGAGTACA ATGTCATGGT TATCGATCTT CTTGGTCCAA GTTTAGAGGA
CTTATTCAAC TACTGCAACA GAAAGTTTTC TCTTAAAACA GTACTTATGC TTGCTGATCA GATGGTGGGT TTTTCTTACT
GAATTCTATT ATTTTGGCTG TTAATTTTGG TTACCTGTAT GACTAAATTT CAATAAATTA ACGATCAAGG AAAGTAAATT
TCAAGACTTT ATTTGTCTGA TTTAACCACT AACTTCCTGT TCTATACAGA TCAACAGGGT AGAGTACATG CACACTAGGG
GGTTTCTACA TCGTGATATC AAGCCAGACA ACTTCCTTAT GGGTTTAGGC CGCAAAGCAA GCCAGGTTTG TCCCATTCAT
CTGCAGTTGC TGGTAGATAT AATTCATTAT TTTTCTGCGC TTTGGATGTT GTTGGTTGCC TGGTCTGTAT AATTTTGTAT
TGATAACATC TTGATTCGAG TATTTGGCCT GGTTTCTAAG TATCATCTTT TTTGGTGCTA TGAAGTTTTG TCAATTGGCA
GTAGTATCTT CAATTATACT TTCTAAGAGA GGCTATGATA TTACCAACAA CAGCTGTCAG CTGTGCTCTG TGTGCTTGAT
GATTATACTA GTTTCTTTAT GGAGAAATTA TCTTGTATAA TAAATTTTAG TATTTTTTAG AAACATCTTT TTTATGAATG
TAGAAAGACT TTGGAGAATT TAAACTGCTG ACTGTGATCA TCGATTTACC ATACGTTTTA TTATTTCGTA AGAACTTGAA
GAATACAAGG ATAATATTTC TGTTTTCTCT TATTTGTGCA TACTGTTACT CAGCATATGC ATATCAACTG CCTTTCTAGT
ACTGCTGCTA ACTGATGATC GAAAGCCTGC ATTTACTTCA TATGTGATAT ATCTTACAAT GAATAACATC AAGAAATAAG
CACAACTTTT TGTAGACATT GTTGTGAGTG ATCTTTACAA TTCTGTAACA GGTTTATGTC ATCGACTATG GTCTTGCAAA
GAAATACCGG GACCTCCAAA CTCATAAGCA TATACCTTAC AGGTAATTAG AAATTCTTCT CTAGTAAATG TTTTAGAAAG
TATTTATGTT TACACCTGGA AGATTGTTGT AGTAGAGCAC TCAGCTTATG AAAAATCATA CTAAAGTATA TTGTTTTGGT
AGCAACACCG TTTTTATCTG ACAGAGCTCA AAGTGCTTAA TTTAGAATTT TTCATTACCA TAACTGTGCT TGGCACACTA
CCGGTGGAGC AGTATCTGCT ATTAACCATA TTGGCAAGCA GTATCTGCTA TTAACTATAT AGATAAGCCC ACACAATTTT
GTTATCTGTT TTTACTTCTT GAAATTAAGA GAAATGCTTG ATAGTAGTGA GTAATGACAG CAGCATTGCA ACAATTTGAT
CAATGATGAT TGTGATAATT GATAAACCAT TTTCTGTTAT GTTTTAGTAC TATACTGTGA CATTGGTCAG TAACACGGGT
TACACTATCA CTATTCACTA CTTAGCAGTT ACCTCCTTCA TACTAATAGT AAAAAGTTTA CCAGTTTATC TACCATTATA
TTTCTATGCA TGATTATGCT TCATACTTTT CTGGGGATAT ATGTTTGAAG CTTACATGTT TTTCTTTCCT ACCATAGGGA
GAACAAAAAT CTCACAGGAA CAGCACGCTA TGCTAGTGTA AACACCCATC TTGGAGTAGG TAAGTGTCTT TACCTGTTAC
TGATTCGTTT TCATCAGAAG AGATTTTATT TTTTAAAAAT CTGAACTAAC GCAAACTAAT ATGTATTTAA GAGGTGCAAA
ATGTGGCAAC ACTGAAAAGT TATGAACAAG TGTAGCTCCT TTGAAACAAA TAAAGTTTAG CTTGCAACAA AATTAGTCAA
TTGCACTCTG ACTGCTAGTA TATGCGTTCT TTTAATTCTG TTTTTCACTA CAGAACAAAG CAGGAGAGAT GATTTAGAGT
CTCTGGGCTA TGTGCTTATG TATTTCTTAA GAGGAAGGTG AGACGATGCT TGTTTTCTAT TTTTTAAAAT TCCATTTTAT
ACGACAATAC ATTTTATTGA TCTATGTTAA CTTGTCCATC TCAGCCTTCC TTGGCAAGGT CTAAAAGCTG GCACAAAAAA
ACAGAAATAT GACAAAATTA GTGAAAAGAA AATGCTTACT CCAGTTGAGG TAATGGAAAT TGGTTTCCAT GCAAAAAAAA
TCTATGAAGA AGCATGACAT TTTTTGATTT AATTGCAACT TAACCTTATC ATATTTTACA CAATTTTGTA TAGGTTCTCT
GTAAATCTTA TCCCACAGAG TTCATTTCAT ACTTCCATTA CTGTCGATCT TTGCGATTTG AAGATAAACC AGACTACAGC
TATTTGAAGA GACTTTTCCG AGATCTATTC ATCCGTGAAG GTATGCTCAA ATATAATACA ATGAAGTATC TCTGCATACA
CATCTAAAAT GATTTCCTCT CAATTCTTGC AGGGTACCAG CTTGATTATA TATTTGATTG GACGAAGCAA GGTTCAGAAA
GTAACAGATT GCGAGTATGT CTGCTATTCC TTTTTCTAAC TTTTTTTGGT AATGCAAAGC TTTACCGTAC TAAATGTGTA
GCATCTTTTC CTTGCTTCCA GTCAAGTGGA AGGACAAGTG GGTTGGTGGG ACCATCTGCA GAACGGACTG AACGAGCTGC
AGGTTTGTCA GTAGCATAGA CATTTTTTGA ATTTATATTT AGGAAATAAG TTTGGAAAAT AACAGGGGTT TTTTGGGGTG
TTGTCTCAAC AGCAAGACAG GATGTTCCTG ACAGATTCTC TGGTACAGTC GATCCATTTG CTAGAAGAAC TGGCTCTGGT
TCTGGCCATT ACGGAGAGCA CACAAAGCAC AGAAATATAT TGGATTCATT ACTTGCACCC AAGACGGTAA GAAATTGAGC
AGCTAGATCA CCTTCTAGCA GTATCCTAAA AAAACTGCTC AAATTAGCAG GATAATGAGA CGGATGTTTC TTCGTTAGTC
TTGACCATCT TTTCGCAGAA ATCTTTTGTT GTGTTTTTAC ATTACGTTGC TGTTGATGAT AGCTGGAACT CTGTATTCTG
GAAGGCTTAT GTCAATTTTA CCATGCGTGC TAGGCTGTTG ATTTAGATAA AAGAAGGCCC ACATCATCAT CTCGTAATGG
GAGCACATCA AGGAAGGCTC TCTTGTCAAG CAGCAGACCA AGTTCTGGAG ATCCCATTGA TCCGAACCGC AGTAACCTAA
TTCCAACCAG CAGTGGCAGC AGTCGCCCAT CAACTATGCA GAGGCTTCAC CAGTCAACAG GACTTGAGAC CAGGTCCTCG
CTTACCAAAA CTGCAAGAAA TGTCCATGAT GATCCCACTT TGAGGACCTT TGAACGCCTT TCAATCAGTG CTGACAGAAG
GAAATAATGC TTCGAAGAGC AAAAGATGTG AGTTGCTGCT CCAGTGAGGA CACTGGGGAT TCCTTCACAC GATGATTACT
GATCAACAAG TAAAAACCAT TCTGTGCTAC AGATGATGCT GAGATATGCT TAAGAGTGAA GTTTGCTTAC TGAATCTTGG
CGCAAAAGAA ATGGTTAAAG AAATCATTTT ACACGCCATT CAGAAGAACC CGGACCAGCA ACTGTGCTGG TCCAATTAAT
GCTGATGTTG ATCAAATATT TGTAGAAATG TTATTGAAAT AAAGCAGTTC ATTACTAGCA AAATATGTAC TATCACGTAG
TATTTCCTTT GTGCACTGCA ACTAGAACTT CTGCCACTCT GCCACTATAC TCTTAAGATA ATCAATATCC TTTTTTGCCT
TAGTGCCCTT TAGATACTCC GTCACATTAT TTCCTTAAAA ACTTGGAGAT CATGTAATCG TTATTAATAT ATCATACGAT
CAGATATCGT TATTCAACTA GC

Locus: Os02g0622100

Loading...

Locus: Os02g0622100

Loading...