Os02t0625000-01

Locus

Os02g0625000

Description

Cryptochrome 2, blue light photoreceptor, Promotion of flowering time

RAP-DB Gene Symbol Synonym(s)

OsCRY2, CRY2

RAP-DB Gene Name Synonym(s)

cryptochrome 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRY2, CRY2

Oryzabase Gene Name Synonym(s)

cryptochrome 2

Transcript Evidence

AK065669

AK099334

AB103094

Protein Evidence

Q852P4

Literature

PMID: 16760221

Note

Manual Curation

September 12, 2016

Gene Ontology (GO)

Biological Process: blue light signaling pathway (GO:0009785)

Molecular Function: blue light photoreceptor activity (GO:0009882)

Functional domain (InterPro)

Cryptochrome/DNA photolyase class 1 (IPR002081)

Cryptochrome, plant (IPR014134)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

DNA photolyase, N-terminal (IPR006050)

Cryptochrome/DNA photolyase, FAD-binding domain (IPR005101)

Cryptochrome/DNA photolyase class 1, conserved site, C-terminal (IPR018394)

Full-length cDNA

J013042O16 (Online Clone Ordering)

J033020H02 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0625000-01)

Others

Oryzabase (11127)

Transcript

2620 bp

>Os02t0625000-01 Cryptochrome 2, blue light photoreceptor, Promotion of flowering time
GGGGGGGGGGTGCGTATGCGTGCGTGTGCGCTGCTTCTTCTCTCAAGTGGTGGAGGGGAA
GAGGAGCACAAGGAGAGGCAGACGGCGATAAGTCGCTCGCTCGCCAATTCGCCATGATCG
GGTGGGGCTCCGCTACCGTACACGCCCCGGAGGAAGCCCAGGCCCCGCCCATGCTGCTGA
GCTCGTGATCCTGCGCTCCTGGCCACAGGCTGCGATTCGGCGTTGGGGTTTCTGGTCCGA
GGCGGCCATCAAGATCCGTGCTTCTTGTCCTTTGGCCCGGGCGGAGTGGTTTCTTTCTTG
CACGGGACGTGCTCGACGGAATGCCTGTGAGGGGAATTCGCTCGCTGTGAGTTGGGAGGG
GTGGTAGCTGTGCTTGCCTGCTTGGTCTGGTCATGGTGGATTGAGTGCTTGGGGGTGGTG
GGATTTGGTCCCTGGGCATGGCCGGTTCGGAGAGGACCGTGGTTTGGTTCAGGAGGGACC
TCAGGATCGACGACAACCCGGCGTTGGCCTCCGCGGCGAGGGACGGCGCTGTGCTCCCTG
TCTTCATATGGTGCCCTGCGGATGAAGGGCAGTTCTATCCCGGCCGGTGCTCCAGGTGGT
GGCTCAAGCAGTCGCTCCCCCACCTCAGCCAGTCACTGGAGTCGCTCGGGTGCCCGCTCG
TGCTGATCCGAGCCGAGAGTACCCTTGAGGCTCTTCTGCGGTGCATTGATTCTGTCGGCG
CCACCAGATTGGTTTATAATCATCTGTATGACCCTGTTTCTCTTGTGCGTGATGACAAAA
TAAAAAAAGAGCTTTCGGCACTGGGAATTTCCATCCAGAGTTTTAATGGTGATCTGCTGT
ATGAGCCATGGGAAATTTATGATGATAGTGGACTTGCATTTACAACCTTTAACATGTACT
GGGAGAAGTGCATGGAATTACCTATTGACGCATCACCGTCACTTGCACCTTGGAAATTGG
TGCCTGTCCCAGGTTTGGAGAGTGTTCGTAGCTGTTCTGTTGATGACCTAGGACTTGAAT
CAAGCAAGGATGAGGAATCAAGTAATGCTTTGCTAATGAGGGCCTGGTCTCCTGGTTGGC
GCAATGCAGAAAAGATGCTTGAAGAATTTGTCTCCCATGGTCTCCTAGAATACTCAAAAC
ATGGAATGAAGGTTGAGGGAGCTACTACATCATTGCTATCACCATATCTTCATTTTGGTG
AGGTGAGTGTAAGAAAAGTATATCAACTTGTAAGGATGCAACAAATCAAGTGGGAAAATG
AGGGAACATCTGAAGCTGAGGAGAGCATTCACTTCTTCATGCGGTCAATTGGTCTTCGAG
AATATTCACGGTACTTGTGTTTTAACTTCCCATTCACACATGAAAAGTCATTGCTGGGGA
ACTTGAAACACTACCCTTGGAAAGTAGATGAGGAGCGGTTCAAGTCCTGGAGGCAGGGAA
TGACAGGATACCCATTGGTAGATGCTGGCATGAGGGAACTTTGGGCTACCGGATGGACAC
ATAATCGGATAAGAGTTATCATTTCAAGTTTTGCTGTGAAATTTCTACTTATCCCATGGA
CTTGGGGTATGAAGTATTTTTGGGATGTGCTATTGGATGCTGATCTGGAAAGTGATATTC
TTGGTTGGCAGTACATATCTGGGAGCCTGCCTGATGGCCATGAGCTCAGTCGTCTTGATA
ATCCAGAGGTTCAAGGTCAAAAGTATGACCCAGATGGTGTATATGTAAGAACTTGGATAC
CTGAACTAGCTAGAATGCCGACAGAATGGATTCATCATCCATGGGATGCACCGAGCTGTA
TTCTTGAAGTTGCTGGAGTTGAGCTGGGGTTTAACTATCCTAAGCCAATCGTAGACCTTC
ACATTGCTAGGGAGTGTTTAGATGATTCCATCTCCACGATGTGGCAATTGGATACAGCTG
AGAAACTTGCAGAATTAGATGGTGAGGTTGTGGAGGACAACTTGAGCAATATCAAGACTT
TTGACATCCCAAAAGTTGTTTTGAGGGAAACATCTCCATGTGCTTTGCCCATTGATCAAA
GAGTGCCCCATGCTAGCAGCAAGGATCATAATTTAAAGTCAAAGGTATTGAAGGCCTCAA
ATAGAAGTTCTATTTGTGTTGATATGATCAGGTCCTCAAAGATGGAAGCAACGAGCTCTG
TAGCAAACTCACCGGTATCAAGGAAAAGATCCTTTTGTGAGACTGCATTTCATGTCCCAT
CTTATTCATCTTCAGCTGAAGTGCATTCGCATATTCAAGATCATGGTGGTTCCTTAGTTG
GGCCTTCAAGATATCTCCTGCAGGAAGCAGGTAGAAACTATGTTGATGAGGTAGAAGATA
GCTCTACCGCAGATAGTGGTTCGAGCATTTCAAGACAACGAAAAGCCGCATAGTTGCTCT
GCTTGACAAGGAAGGGTGAAGGTGTACTCAACTAAGGGTGTGTAGGAGTAAAACTTGTGT
GATCATAAGGAAATTTTGTACATTCTGTAATCTGTTTATTTTTGCTTTTTGTGACACATT
CTGTAACTAGCTGAGAACTGAGCTGACACGGTTTCCTCGCCCAAAAGAAAAAAAAAATGC
AACATCTTTCCTTCGTTGCAATAAGAGAAACTTCTCATCC

CDS

1956 bp

>Os02t0625000-01 Cryptochrome 2, blue light photoreceptor, Promotion of flowering time
ATGGCCGGTTCGGAGAGGACCGTGGTTTGGTTCAGGAGGGACCTCAGGATCGACGACAAC
CCGGCGTTGGCCTCCGCGGCGAGGGACGGCGCTGTGCTCCCTGTCTTCATATGGTGCCCT
GCGGATGAAGGGCAGTTCTATCCCGGCCGGTGCTCCAGGTGGTGGCTCAAGCAGTCGCTC
CCCCACCTCAGCCAGTCACTGGAGTCGCTCGGGTGCCCGCTCGTGCTGATCCGAGCCGAG
AGTACCCTTGAGGCTCTTCTGCGGTGCATTGATTCTGTCGGCGCCACCAGATTGGTTTAT
AATCATCTGTATGACCCTGTTTCTCTTGTGCGTGATGACAAAATAAAAAAAGAGCTTTCG
GCACTGGGAATTTCCATCCAGAGTTTTAATGGTGATCTGCTGTATGAGCCATGGGAAATT
TATGATGATAGTGGACTTGCATTTACAACCTTTAACATGTACTGGGAGAAGTGCATGGAA
TTACCTATTGACGCATCACCGTCACTTGCACCTTGGAAATTGGTGCCTGTCCCAGGTTTG
GAGAGTGTTCGTAGCTGTTCTGTTGATGACCTAGGACTTGAATCAAGCAAGGATGAGGAA
TCAAGTAATGCTTTGCTAATGAGGGCCTGGTCTCCTGGTTGGCGCAATGCAGAAAAGATG
CTTGAAGAATTTGTCTCCCATGGTCTCCTAGAATACTCAAAACATGGAATGAAGGTTGAG
GGAGCTACTACATCATTGCTATCACCATATCTTCATTTTGGTGAGGTGAGTGTAAGAAAA
GTATATCAACTTGTAAGGATGCAACAAATCAAGTGGGAAAATGAGGGAACATCTGAAGCT
GAGGAGAGCATTCACTTCTTCATGCGGTCAATTGGTCTTCGAGAATATTCACGGTACTTG
TGTTTTAACTTCCCATTCACACATGAAAAGTCATTGCTGGGGAACTTGAAACACTACCCT
TGGAAAGTAGATGAGGAGCGGTTCAAGTCCTGGAGGCAGGGAATGACAGGATACCCATTG
GTAGATGCTGGCATGAGGGAACTTTGGGCTACCGGATGGACACATAATCGGATAAGAGTT
ATCATTTCAAGTTTTGCTGTGAAATTTCTACTTATCCCATGGACTTGGGGTATGAAGTAT
TTTTGGGATGTGCTATTGGATGCTGATCTGGAAAGTGATATTCTTGGTTGGCAGTACATA
TCTGGGAGCCTGCCTGATGGCCATGAGCTCAGTCGTCTTGATAATCCAGAGGTTCAAGGT
CAAAAGTATGACCCAGATGGTGTATATGTAAGAACTTGGATACCTGAACTAGCTAGAATG
CCGACAGAATGGATTCATCATCCATGGGATGCACCGAGCTGTATTCTTGAAGTTGCTGGA
GTTGAGCTGGGGTTTAACTATCCTAAGCCAATCGTAGACCTTCACATTGCTAGGGAGTGT
TTAGATGATTCCATCTCCACGATGTGGCAATTGGATACAGCTGAGAAACTTGCAGAATTA
GATGGTGAGGTTGTGGAGGACAACTTGAGCAATATCAAGACTTTTGACATCCCAAAAGTT
GTTTTGAGGGAAACATCTCCATGTGCTTTGCCCATTGATCAAAGAGTGCCCCATGCTAGC
AGCAAGGATCATAATTTAAAGTCAAAGGTATTGAAGGCCTCAAATAGAAGTTCTATTTGT
GTTGATATGATCAGGTCCTCAAAGATGGAAGCAACGAGCTCTGTAGCAAACTCACCGGTA
TCAAGGAAAAGATCCTTTTGTGAGACTGCATTTCATGTCCCATCTTATTCATCTTCAGCT
GAAGTGCATTCGCATATTCAAGATCATGGTGGTTCCTTAGTTGGGCCTTCAAGATATCTC
CTGCAGGAAGCAGGTAGAAACTATGTTGATGAGGTAGAAGATAGCTCTACCGCAGATAGT
GGTTCGAGCATTTCAAGACAACGAAAAGCCGCATAG

Protein

652 aa

>Os02t0625000-01 Cryptochrome 2, blue light photoreceptor, Promotion of flowering time
MAGSERTVVWFRRDLRIDDNPALASAARDGAVLPVFIWCPADEGQFYPGRCSRWWLKQSL
PHLSQSLESLGCPLVLIRAESTLEALLRCIDSVGATRLVYNHLYDPVSLVRDDKIKKELS
ALGISIQSFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDASPSLAPWKLVPVPGL
ESVRSCSVDDLGLESSKDEESSNALLMRAWSPGWRNAEKMLEEFVSHGLLEYSKHGMKVE
GATTSLLSPYLHFGEVSVRKVYQLVRMQQIKWENEGTSEAEESIHFFMRSIGLREYSRYL
CFNFPFTHEKSLLGNLKHYPWKVDEERFKSWRQGMTGYPLVDAGMRELWATGWTHNRIRV
IISSFAVKFLLIPWTWGMKYFWDVLLDADLESDILGWQYISGSLPDGHELSRLDNPEVQG
QKYDPDGVYVRTWIPELARMPTEWIHHPWDAPSCILEVAGVELGFNYPKPIVDLHIAREC
LDDSISTMWQLDTAEKLAELDGEVVEDNLSNIKTFDIPKVVLRETSPCALPIDQRVPHAS
SKDHNLKSKVLKASNRSSICVDMIRSSKMEATSSVANSPVSRKRSFCETAFHVPSYSSSA
EVHSHIQDHGGSLVGPSRYLLQEAGRNYVDEVEDSSTADSGSSISRQRKAA*

5'UTR

chr02:24915862..24916086 (+ strand) : 225 bp

chr02:24916212..24916423 (+ strand) : 212 bp

CDS

chr02:24916424..24916736 (+ strand) : 313 bp

chr02:24917894..24918115 (+ strand) : 222 bp

chr02:24918383..24919098 (+ strand) : 716 bp

chr02:24920340..24920981 (+ strand) : 642 bp

chr02:24921794..24921856 (+ strand) : 63 bp

3'UTR

chr02:24921857..24922083 (+ strand) : 227 bp

FASTA

>Os02t0625000-01 class=Sequence position=chr02:24915862..24922083 (+ strand)
GGGGGGGGGG TGCGTATGCG TGCGTGTGCG CTGCTTCTTC TCTCAAGTGG TGGAGGGGAA GAGGAGCACA AGGAGAGGCA
GACGGCGATA AGTCGCTCGC TCGCCAATTC GCCATGATCG GGTGGGGCTC CGCTACCGTA CACGCCCCGG AGGAAGCCCA
GGCCCCGCCC ATGCTGCTGA GCTCGTGATC CTGCGCTCCT GGCCACAGGC TGCGATTCGG CGTTGGTGCG CCCACCCTCG
ATCTTGGCCG CTTGCGCGCT TCCACGATCT GAGTATCCTG TCGCGTACTG GGGTCTTAAT TAATTTACTA GTGACCGTGC
TCATCTTCTT CTTCTTCCTC CTCCTTGCAG GGGTTTCTGG TCCGAGGCGG CCATCAAGAT CCGTGCTTCT TGTCCTTTGG
CCCGGGCGGA GTGGTTTCTT TCTTGCACGG GACGTGCTCG ACGGAATGCC TGTGAGGGGA ATTCGCTCGC TGTGAGTTGG
GAGGGGTGGT AGCTGTGCTT GCCTGCTTGG TCTGGTCATG GTGGATTGAG TGCTTGGGGG TGGTGGGATT TGGTCCCTGG
GCATGGCCGG TTCGGAGAGG ACCGTGGTTT GGTTCAGGAG GGACCTCAGG ATCGACGACA ACCCGGCGTT GGCCTCCGCG
GCGAGGGACG GCGCTGTGCT CCCTGTCTTC ATATGGTGCC CTGCGGATGA AGGGCAGTTC TATCCCGGCC GGTGCTCCAG
GTGGTGGCTC AAGCAGTCGC TCCCCCACCT CAGCCAGTCA CTGGAGTCGC TCGGGTGCCC GCTCGTGCTG ATCCGAGCCG
AGAGTACCCT TGAGGCTCTT CTGCGGTGCA TTGATTCTGT CGGCGCCACC AGATTGGTTT ATAATCATCT GTATGGTATG
GCTACTTTCT CATGGCGTTT CCTGCATCAA TGGAGTTTCT TATATGTTGT GTTATTCTAT TTCTTTGTGA AAATATTTTT
TTTTCTTTAC ACTTTGGATG CGAAGAAATC TGACCATGAC GACTTTGAAA GTCTTAGCCA GCTACATCAT GTACTTTTAT
GTTGTCAAAA GGCTCAACTT AATAAGTTAT GTAACATTTG ATCAAAAGCT ATTCCGAGTG AAGCCTTGTA AACAACATCA
TAGATCTTTT TTTTTTAAGA AAATGGATTA AAATCATAGA TCATGCCAGT TGCTTACATG CTGTTCTAAA TGTAAATACA
GTAGAAAGTT CTCTCAATTT ATCCATGGTT ATGTATCATA AGTCAGTTCA TTTAGTTGGT ATTGACATGA TATGTGCTAC
AAACATCACT AATACACATT TTCCCCACAA ATATAAAAAA TATTCAAATT CATATATAGG AAGAAGGAAA CTATCTCTAA
ACAATTAAAA TTGCATTATA TGTAGTAATC TGGCAGTAGT TTTTCCTATC AAAAATTCAT AACAATAGCT TTCGAAAAGA
ATAAGGCAAA AAGCATATGC GCATGAAAAT AGAAACTAGG CCAAGTATGA TTAACATAAA tacttcctcc gtttcatatt
ataagacttt ctagcattgc ccacattcat atatatgtta ataaatctag atatatatgt gtgcctagat tcattaatat
ctatatgaat gtgggcaatg ttagaaaatc ttataacctg aaacggaggt agtaCTACAT AATAAAGTGC CAAATAAATC
TTTAGGGGCT AACTTGAACC AACTATAGCT TATGGTCTTA TTTGTCATAG TTCCACTCTT CAAATATCAA ATACCAAATA
CTATAAACTG TCACATCAGA GGGGAAAATC AAACTCAAAG GTTTGACATT GCAAAATGAG ACGGCCTTTT CCATTTGAGC
TAGTACAATA TTGATATGAA ATAAACAACT TTGGGTTTTC TAGTTCAGAC TTCAGAAACG TGTACCTCTA AAGTTGGTAC
GGAGTACAGC TGTGTTCTCT ATTGTTCCAT TCCACTAGCA GTTTTGTTTT AAAATTACTC TTTTCAGATA TGCTGGTTTA
ATCTTATTTG TTCTCACTCT TCTAAATTTT AGACCCTGTT TCTCTTGTGC GTGATGACAA AATAAAAAAA GAGCTTTCGG
CACTGGGAAT TTCCATCCAG AGTTTTAATG GTGATCTGCT GTATGAGCCA TGGGAAATTT ATGATGATAG TGGACTTGCA
TTTACAACCT TTAACATGTA CTGGGAGAAG TGCATGGAAT TACCTATTGA CGCATCACCG TCACTTGCAC CTTGGAAATT
GGTGCCTGTC CCAGGTAGAT CGTGGCTAGT GGCCTACCAT TATTTATCTT TTTTATTTTT GAAGATTTTC TATGttttta
atttgtctgt acttacagaa ttatctctag attaagttgt ttaccttttt tcgagaagtt atttacttgc aagcattact
cgttttatat ttacagattt agtaattgat gcccttcaac ctttacactc aatGAGTCAA TGTCTAGTTT GTCAAGATAC
AGCTACTTTA ATGCTTAACA ATTTTTCAGT TTGACATTCA GGTTTGGAGA GTGTTCGTAG CTGTTCTGTT GATGACCTAG
GACTTGAATC AAGCAAGGAT GAGGAATCAA GTAATGCTTT GCTAATGAGG GCCTGGTCTC CTGGTTGGCG CAATGCAGAA
AAGATGCTTG AAGAATTTGT CTCCCATGGT CTCCTAGAAT ACTCAAAACA TGGAATGAAG GTTGAGGGAG CTACTACATC
ATTGCTATCA CCATATCTTC ATTTTGGTGA GGTGAGTGTA AGAAAAGTAT ATCAACTTGT AAGGATGCAA CAAATCAAGT
GGGAAAATGA GGGAACATCT GAAGCTGAGG AGAGCATTCA CTTCTTCATG CGGTCAATTG GTCTTCGAGA ATATTCACGG
TACTTGTGTT TTAACTTCCC ATTCACACAT GAAAAGTCAT TGCTGGGGAA CTTGAAACAC TACCCTTGGA AAGTAGATGA
GGAGCGGTTC AAGTCCTGGA GGCAGGGAAT GACAGGATAC CCATTGGTAG ATGCTGGCAT GAGGGAACTT TGGGCTACCG
GATGGACACA TAATCGGATA AGAGTTATCA TTTCAAGTTT TGCTGTGAAA TTTCTACTTA TCCCATGGAC TTGGGGTATG
AAGTATTTTT GGGATGTGCT ATTGGATGCT GATCTGGAAA GTGATATTCT TGGTTGGCAG TACATATCTG GGAGCCTGCC
TGATGGCCAT GAGCTCAGTC GTCTTGATAA TCCAGAGGTA TGCAGTCACT AAAGCACAAA ATCCTTTTTT TTTTTTTTTT
TTTGCTATCA GGTAAGCTTG ATTAAGGCAT GCTTGGTCTT TACCACATTT TCGATGGCCC TTGTGCAAAA ATGTCGCTTG
ACACAGTATT TATGGTAATC AAGTCACCCA CCACACTTGG GACATGAACC AAACTAGCCA TACTTTATCG AATTTGCTTA
CATTGATGTG GCAAACTGTG GCATTAAACT AAATACAGGA ATTTAGGAAT TTCTCTTCAT TAGAAAGTTC ATATATGATG
AGACTAGAAT AGATTTTTAT ATCCATGAAA TTCTCCACAG ATCATCCACA TTTCACTATT CAGTTAAAAG GTGTTGAAGA
GAAACAGCTC AAGGAAAACG TTAGTTAAAA GAATTCTGAC TGTAGTGTAG TTACTAACCT AGGCAAACTT TTCCTGGCTT
GGCTGAGGCA TAAAACTGAG CTAGGATTTG CACCCTTGGA GTGGGAAGCA AATGATTTTT AGGTATGCCA CCTTACTATT
TGTTTTTCTA TAAAATGCCA TGTGCACGTT TGTCATACTC TCACTGAGTG GCATTCTAGA ACTTTACTTT ATCACAAATG
GAGTGACACT CAATCAAGTA ATTCTACATA AAGAGCAAGC TGAATTTTGT TTTTTCCCTC TAAAAGACAG TGGCTGCCAG
GCCAAGCTTG CGAACCTAAT TGTGTACTGA CGAGATCATA GCCCAGCGGC CTCAGCCAAC TTGAAAAATA ACTTGGCATG
GCCAGCATAT GTTGCCTTAT TTTTTTTCCC TTTAACAAGG GTCGATATGA TGAAACTTAA ATTGGCACAG ATAGTATATT
TTGGTTATTG TAGTTTGGTT TTCATTGTTC TTGTAGATTA TGGAAAATGT GATTGCTACG TATTATGCCT TGTGCATATG
GTATTAATAT ATGTGATTTT ACTGTTTCTG CCATCCACCC TACAATTTTC CCTTGTCACT TGTATAATGT ATTGTCTATA
ATCAAAATTT TACGATATAT GGTTTACCTT GGCACTTCCT ACAGATGCAT TGACAAAACT TTGTGGCCTT CCTTTCTGCT
TAGTTTTCAA CTTGTGATTT TTTGAAGTTT CACTGTACTA TTAGGCAGAA GAGCTCCCTT GTGTTATACT TATTTTATGT
GTCTAAGTAC CAAGTGTTTT ATCCATGACA TGCAAGATAT TTATGTTTCC CTATTTGGCT TTTTTGATGC AAAACTAGGT
TCAAGGTCAA AAGTATGACC CAGATGGTGT ATATGTAAGA ACTTGGATAC CTGAACTAGC TAGAATGCCG ACAGAATGGA
TTCATCATCC ATGGGATGCA CCGAGCTGTA TTCTTGAAGT TGCTGGAGTT GAGCTGGGGT TTAACTATCC TAAGCCAATC
GTAGACCTTC ACATTGCTAG GGAGTGTTTA GATGATTCCA TCTCCACGAT GTGGCAATTG GATACAGCTG AGAAACTTGC
AGAATTAGAT GGTGAGGTTG TGGAGGACAA CTTGAGCAAT ATCAAGACTT TTGACATCCC AAAAGTTGTT TTGAGGGAAA
CATCTCCATG TGCTTTGCCC ATTGATCAAA GAGTGCCCCA TGCTAGCAGC AAGGATCATA ATTTAAAGTC AAAGGTATTG
AAGGCCTCAA ATAGAAGTTC TATTTGTGTT GATATGATCA GGTCCTCAAA GATGGAAGCA ACGAGCTCTG TAGCAAACTC
ACCGGTATCA AGGAAAAGAT CCTTTTGTGA GACTGCATTT CATGTCCCAT CTTATTCATC TTCAGCTGAA GTGCATTCGC
ATATTCAAGA TCATGGTGGT TCCTTAGTTG GGCCTTCAAG ATATCTCCTG CAGGAAGCAG GTAGAAACTA TGTTGATGAG
GTAAGCTTAA TCATCATATT TGATAGACAA GTGCTGAAAA ATTTAATGCG ATATTTTCAT CTTTGTAGTT TTTTTTATCA
GGAAAGCAAA CATCCCATGA AATTACCACC ACAAGACCTA TAAACATAAT AACATTCAAC CTCCAAAGTA CTAGGTTTAA
AGTTTAAACA GCTTCGAACA CTCCATGATA TAGATGGTAT TCTGAAGTTG TGTCTTCTGC TTCTTTACAG CCAACATGAA
CTGTGTGGAG CGCCTGTATC GTGATCTTAG CTAATCTTAA TTCTGACAAC AGCTTCTGCT ATAATGACAA ACTCATGATA
TATTATTGCT GCAAGCTGAC CAGCTTCTGT CGGCATAAAT GGCTTTATTG GATAATCTAG GTGCTCAGGA TGGGTAGTGG
AAACCCACCC ATTTCACACT TCCACTGCTT CTAGAACTAA GTCTAACAAG TCTTGATAGG ATTAGTAAAA CTGTGCAAGT
CTTTGTAGTC AAATTTCACG GCATGTATAT TTCAGTAGAT ATTGCTGGAG GTAAAGCCTC CATCGAGAAA CAAGATAGCA
CCCAACCTAT GTTTAACTAT GATACTTTTT CTGGCATCTT TTTGGGATTT TTTGTAGGGG CATCTTTTGG GATTTTACTT
CTGTGTGTAT ACCACGGGCA CAAATTCTCT GCTCAGTAAA TTAACAGCCA CGGCATTGAA CCATTATTTG CATGTCTTAT
CTATGCATAA CATCCTATCC CCACTTAACT GACCATACAT GTTACTCTAC ACTGCTTGAC TGCTTCACAT CCAAACTAAT
GCCACTTTGC AGGTAGAAGA TAGCTCTACC GCAGATAGTG GTTCGAGCAT TTCAAGACAA CGAAAAGCCG CATAGTTGCT
CTGCTTGACA AGGAAGGGTG AAGGTGTACT CAACTAAGGG TGTGTAGGAG TAAAACTTGT GTGATCATAA GGAAATTTTG
TACATTCTGT AATCTGTTTA TTTTTGCTTT TTGTGACACA TTCTGTAACT AGCTGAGAAC TGAGCTGACA CGGTTTCCTC
GCCCAAAAGA AAAAAAAAAT GCAACATCTT TCCTTCGTTG CAATAAGAGA AACTTCTCAT CC

Locus: Os02g0625000

Loading...

Locus: Os02g0625000

Loading...