Os02t0625000-02

Locus

Os02g0625000

Description

Similar to Cryptochrome 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRY2, CRY2

Oryzabase Gene Name Synonym(s)

cryptochrome 2

Transcript Evidence

AK068394 (DDBJ, Best hit)

Protein Evidence

Q852P4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: DNA repair (GO:0006281)

Molecular Function: DNA photolyase activity (GO:0003913)

Functional domain (InterPro)

DNA photolyase, FAD-binding/Cryptochrome, C-terminal (IPR005101)

DNA photolyase, N-terminal (IPR006050)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Full-length cDNA

J013149M17 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0625000-02)

Others

Oryzabase (11127)

Transcript

2603 bp

>Os02t0625000-02 Similar to Cryptochrome 2.
ATGCGTGCGTGTGCGCTGCTTCTTCTCTCAAGTGGTGGAGGGGAAGAGGAGCACAAGGAG
AGGCAGACGGCGATAAGTCGCTCGCTCGCCAATTCGCCATGATCGGGTGGGGCTCCGCTA
CCGTACACGCCCCGGAGGAAGCCCAGGCCCCGCCCATGCTGCTGAGCTCGTGATCCTGCG
CTCCTGGCCACAGGCTGCGATTCGGCGTTGGGGTTTCTGGTCCGAGGCGGCCATCAAGAT
CCGTGCTTCTTGTCCTTTGGCCCGGGCGGAGTGGTTTCTTTCTTGCACGGGACGTGCTCG
ACGGAATGCCTGTGAGGGGAATTCGCTCGCTGTGAGTTGGGAGGGGTGGTAGCTGTGCTT
GCCTGCTTGGTCTGGTCATGGTGGATTGAGTGCTTGGGGGTGGTGGGATTTGGTCCCTGG
GCATGGCCGGTTCGGAGAGGACCGTGGTTTGGTTCAGGAGGGACCTCAGGATCGACGACA
ACCCGGCGTTGGCCTCCGCGGCGAGGGACGGCGCTGTGCTCCCTGTCTTCATATGGTGCC
CTGCGGATGAAGGGCAGTTCTATCCCGGCCGGTGCTCCAGGTGGTGGCTCAAGCAGTCGC
TCCCCCACCTCAGCCAGTCACTGGAGTCGCTCGGGTGCCCGCTCGTGCTGATCCGAGCCG
AGAGTACCCTTGAGGCTCTTCTGCGGTGCATTGATTCTGTCGGCGCCACCAGATTGGTTT
ATAATCATCTGTATGACCCTGTTTCTCTTGTGCGTGATGACAAAATAAAAAAAGAGCTTT
CGGCACTGGGAATTTCCATCCAGAGTTTTAATGGTGATCTGCTGTATGAGCCATGGGAAA
TTTATGATGATAGTGGACTTGCATTTACAACCTTTAACATGTACTGGGAGAAGTGCATGG
AATTACCTATTGACGCATCACCGTCACTTGCACCTTGGAAATTGGTGCCTGTCCCAGGTT
TGGAGAGTGTTCGTAGCTGTTCTGTTGATGACCTAGGACTTGAATCAAGCAAGGATGAGG
AATCAAGTAATGCTTTGCTAATGAGGGCCTGGTCTCCTGGTTGGCGCAATGCAGAAAAGA
TGCTTGAAGAATTTGTCTCCCATGGTCTCCTAGAATACTCAAAACATGGAATGAAGGTTG
AGGGAGCTACTACATCATTGCTATCACCATATCTTCATTTTGGTGAGGTGAGTGTAAGAA
AAGTATATCAACTTGTAAGGATGCAACAAATCAAGTGGGAAAATGAGGGAACATCTGAAG
CTGAGGAGAGCATTCACTTCTTCATGCGGTCAATTGGTCTTCGAGAATATTCACGATGAG
GAGCGGTTCAAGTCCTGGAGGCAGGGAATGACAGGATACCCATTGGTAGATGCTGGCATG
AGGGAACTTTGGGCTACCGGATGGACACATAATCGGATAAGAGTTATCATTTCAAGTTTT
GCTGTGAAATTTCTACTTATCCCATGGACTTGGGGTATGAAGTATTTTTGGGATGTGCTA
TTGGATGCTGATCTGGAAAGTGATATTCTTGGTTGGCAGTACATATCTGGGAGCCTGCCT
GATGGCCATGAGCTCAGTCGTCTTGATAATCCAGAGGTTCAAGGTCAAAAGTATGACCCA
GATGGTGTATATGTAAGAACTTGGATACCTGAACTAGCTAGAATGCCGACAGAATGGATT
CATCATCCATGGGATGCACCGAGCTGTATTCTTGAAGTTGCTGGAGTTGAGCTGGGGTTT
AACTATCCTAAGCCAATCGTAGACCTTCACATTGCTAGGGAGTGTTTAGATGATTCCATC
TCCACGATGTGGCAATTGGATACAGCTGAGAAACTTGCAGAATTAGATGGTGAGGTTGTG
GAGGACAACTTGAGCAATATCAAGACTTTTGACATCCCAAAAGTTGTTTTGAGGGAAACA
TCTCCATGTGCTTTGCCCATTGATCAAAGAGTGCCCCATGCTAGCAGCAAGGATCATAAT
TTAAAGTCAAAGGTATTGAAGGCCTCAAATAGAAGTTCTATTTGTGTTGATATGATCAGG
TCCTCAAAGATGGAAGCAACGAGCTCTGTAGCAAACTCACCGGTATCAAGGAAAAGATCC
TTTTGTGAGACTGCATTTCATGTCCCATCTTATTCATCTTCAGCTGAAGTGCATTCGCAT
ATTCAAGATCATGGTGGTTCCTTAGTTGGGCCTTCAAGATATCTCCTGCAGGAAGCAGGT
AGAAACTATGTTGATGAGCCAACATGAACTGTGTGGAGCGCCTGTATCGTGATCTTAGCT
AATCTTAATTCTGACAACAGCTTCTGCTATAATGACAAACTCATGATATATTATTGCTGC
AAGCTGACCAGCTTCTGTCGGCATAAATGGCTTTATTGGATAATCTAGGTGCTCAGGATG
GGTAGTGGAAACCCACCCATTTCACACTTCCACTGCTTCTAGAACTAAGTCTAACAAGTC
TTGATAGGATTAGTAAAACTGTGCAAGTCTTTGTAGTCAAATTTCACGGCATGTATATTT
CAGTAGATATTGCTGGAGGTAAAGCCTCCATCGAGAAACAAGATAGCACCCAACCTATGT
TTAACTATGATACTTTTTCTGGC

CDS

897 bp

>Os02t0625000-02 Similar to Cryptochrome 2.
ATGGCCGGTTCGGAGAGGACCGTGGTTTGGTTCAGGAGGGACCTCAGGATCGACGACAAC
CCGGCGTTGGCCTCCGCGGCGAGGGACGGCGCTGTGCTCCCTGTCTTCATATGGTGCCCT
GCGGATGAAGGGCAGTTCTATCCCGGCCGGTGCTCCAGGTGGTGGCTCAAGCAGTCGCTC
CCCCACCTCAGCCAGTCACTGGAGTCGCTCGGGTGCCCGCTCGTGCTGATCCGAGCCGAG
AGTACCCTTGAGGCTCTTCTGCGGTGCATTGATTCTGTCGGCGCCACCAGATTGGTTTAT
AATCATCTGTATGACCCTGTTTCTCTTGTGCGTGATGACAAAATAAAAAAAGAGCTTTCG
GCACTGGGAATTTCCATCCAGAGTTTTAATGGTGATCTGCTGTATGAGCCATGGGAAATT
TATGATGATAGTGGACTTGCATTTACAACCTTTAACATGTACTGGGAGAAGTGCATGGAA
TTACCTATTGACGCATCACCGTCACTTGCACCTTGGAAATTGGTGCCTGTCCCAGGTTTG
GAGAGTGTTCGTAGCTGTTCTGTTGATGACCTAGGACTTGAATCAAGCAAGGATGAGGAA
TCAAGTAATGCTTTGCTAATGAGGGCCTGGTCTCCTGGTTGGCGCAATGCAGAAAAGATG
CTTGAAGAATTTGTCTCCCATGGTCTCCTAGAATACTCAAAACATGGAATGAAGGTTGAG
GGAGCTACTACATCATTGCTATCACCATATCTTCATTTTGGTGAGGTGAGTGTAAGAAAA
GTATATCAACTTGTAAGGATGCAACAAATCAAGTGGGAAAATGAGGGAACATCTGAAGCT
GAGGAGAGCATTCACTTCTTCATGCGGTCAATTGGTCTTCGAGAATATTCACGATGA

Protein

299 aa

>Os02t0625000-02 Similar to Cryptochrome 2.
MAGSERTVVWFRRDLRIDDNPALASAARDGAVLPVFIWCPADEGQFYPGRCSRWWLKQSL
PHLSQSLESLGCPLVLIRAESTLEALLRCIDSVGATRLVYNHLYDPVSLVRDDKIKKELS
ALGISIQSFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDASPSLAPWKLVPVPGL
ESVRSCSVDDLGLESSKDEESSNALLMRAWSPGWRNAEKMLEEFVSHGLLEYSKHGMKVE
GATTSLLSPYLHFGEVSVRKVYQLVRMQQIKWENEGTSEAEESIHFFMRSIGLREYSR*

5'UTR

chr02:24915877..24916086 (+ strand) : 210 bp

chr02:24916212..24916423 (+ strand) : 212 bp

CDS

chr02:24916424..24916736 (+ strand) : 313 bp

chr02:24917894..24918115 (+ strand) : 222 bp

chr02:24918383..24918740 (+ strand) : 358 bp

chr02:24918818..24918821 (+ strand) : 4 bp

3'UTR

chr02:24918822..24919098 (+ strand) : 277 bp

chr02:24920340..24920981 (+ strand) : 642 bp

chr02:24921212..24921576 (+ strand) : 365 bp

FASTA

>Os02t0625000-02 class=Sequence position=chr02:24915877..24921576 (+ strand)
ATGCGTGCGT GTGCGCTGCT TCTTCTCTCA AGTGGTGGAG GGGAAGAGGA GCACAAGGAG AGGCAGACGG CGATAAGTCG
CTCGCTCGCC AATTCGCCAT GATCGGGTGG GGCTCCGCTA CCGTACACGC CCCGGAGGAA GCCCAGGCCC CGCCCATGCT
GCTGAGCTCG TGATCCTGCG CTCCTGGCCA CAGGCTGCGA TTCGGCGTTG GTGCGCCCAC CCTCGATCTT GGCCGCTTGC
GCGCTTCCAC GATCTGAGTA TCCTGTCGCG TACTGGGGTC TTAATTAATT TACTAGTGAC CGTGCTCATC TTCTTCTTCT
TCCTCCTCCT TGCAGGGGTT TCTGGTCCGA GGCGGCCATC AAGATCCGTG CTTCTTGTCC TTTGGCCCGG GCGGAGTGGT
TTCTTTCTTG CACGGGACGT GCTCGACGGA ATGCCTGTGA GGGGAATTCG CTCGCTGTGA GTTGGGAGGG GTGGTAGCTG
TGCTTGCCTG CTTGGTCTGG TCATGGTGGA TTGAGTGCTT GGGGGTGGTG GGATTTGGTC CCTGGGCATG GCCGGTTCGG
AGAGGACCGT GGTTTGGTTC AGGAGGGACC TCAGGATCGA CGACAACCCG GCGTTGGCCT CCGCGGCGAG GGACGGCGCT
GTGCTCCCTG TCTTCATATG GTGCCCTGCG GATGAAGGGC AGTTCTATCC CGGCCGGTGC TCCAGGTGGT GGCTCAAGCA
GTCGCTCCCC CACCTCAGCC AGTCACTGGA GTCGCTCGGG TGCCCGCTCG TGCTGATCCG AGCCGAGAGT ACCCTTGAGG
CTCTTCTGCG GTGCATTGAT TCTGTCGGCG CCACCAGATT GGTTTATAAT CATCTGTATG GTATGGCTAC TTTCTCATGG
CGTTTCCTGC ATCAATGGAG TTTCTTATAT GTTGTGTTAT TCTATTTCTT TGTGAAAATA TTTTTTTTTC TTTACACTTT
GGATGCGAAG AAATCTGACC ATGACGACTT TGAAAGTCTT AGCCAGCTAC ATCATGTACT TTTATGTTGT CAAAAGGCTC
AACTTAATAA GTTATGTAAC ATTTGATCAA AAGCTATTCC GAGTGAAGCC TTGTAAACAA CATCATAGAT CTTTTTTTTT
TAAGAAAATG GATTAAAATC ATAGATCATG CCAGTTGCTT ACATGCTGTT CTAAATGTAA ATACAGTAGA AAGTTCTCTC
AATTTATCCA TGGTTATGTA TCATAAGTCA GTTCATTTAG TTGGTATTGA CATGATATGT GCTACAAACA TCACTAATAC
ACATTTTCCC CACAAATATA AAAAATATTC AAATTCATAT ATAGGAAGAA GGAAACTATC TCTAAACAAT TAAAATTGCA
TTATATGTAG TAATCTGGCA GTAGTTTTTC CTATCAAAAA TTCATAACAA TAGCTTTCGA AAAGAATAAG GCAAAAAGCA
TATGCGCATG AAAATAGAAA CTAGGCCAAG TATGATTAAC ATAAAtactt cctccgtttc atattataag actttctagc
attgcccaca ttcatatata tgttaataaa tctagatata tatgtgtgcc tagattcatt aatatctata tgaatgtggg
caatgttaga aaatcttata acctgaaacg gaggtagtaC TACATAATAA AGTGCCAAAT AAATCTTTAG GGGCTAACTT
GAACCAACTA TAGCTTATGG TCTTATTTGT CATAGTTCCA CTCTTCAAAT ATCAAATACC AAATACTATA AACTGTCACA
TCAGAGGGGA AAATCAAACT CAAAGGTTTG ACATTGCAAA ATGAGACGGC CTTTTCCATT TGAGCTAGTA CAATATTGAT
ATGAAATAAA CAACTTTGGG TTTTCTAGTT CAGACTTCAG AAACGTGTAC CTCTAAAGTT GGTACGGAGT ACAGCTGTGT
TCTCTATTGT TCCATTCCAC TAGCAGTTTT GTTTTAAAAT TACTCTTTTC AGATATGCTG GTTTAATCTT ATTTGTTCTC
ACTCTTCTAA ATTTTAGACC CTGTTTCTCT TGTGCGTGAT GACAAAATAA AAAAAGAGCT TTCGGCACTG GGAATTTCCA
TCCAGAGTTT TAATGGTGAT CTGCTGTATG AGCCATGGGA AATTTATGAT GATAGTGGAC TTGCATTTAC AACCTTTAAC
ATGTACTGGG AGAAGTGCAT GGAATTACCT ATTGACGCAT CACCGTCACT TGCACCTTGG AAATTGGTGC CTGTCCCAGG
TAGATCGTGG CTAGTGGCCT ACCATTATTT ATCTTTTTTA TTTTTGAAGA TTTTCTATGt ttttaatttg tctgtactta
cagaattatc tctagattaa gttgtttacc ttttttcgag aagttattta cttgcaagca ttactcgttt tatatttaca
gatttagtaa ttgatgccct tcaaccttta cactcaatGA GTCAATGTCT AGTTTGTCAA GATACAGCTA CTTTAATGCT
TAACAATTTT TCAGTTTGAC ATTCAGGTTT GGAGAGTGTT CGTAGCTGTT CTGTTGATGA CCTAGGACTT GAATCAAGCA
AGGATGAGGA ATCAAGTAAT GCTTTGCTAA TGAGGGCCTG GTCTCCTGGT TGGCGCAATG CAGAAAAGAT GCTTGAAGAA
TTTGTCTCCC ATGGTCTCCT AGAATACTCA AAACATGGAA TGAAGGTTGA GGGAGCTACT ACATCATTGC TATCACCATA
TCTTCATTTT GGTGAGGTGA GTGTAAGAAA AGTATATCAA CTTGTAAGGA TGCAACAAAT CAAGTGGGAA AATGAGGGAA
CATCTGAAGC TGAGGAGAGC ATTCACTTCT TCATGCGGTC AATTGGTCTT CGAGAATATT CACGGTACTT GTGTTTTAAC
TTCCCATTCA CACATGAAAA GTCATTGCTG GGGAACTTGA AACACTACCC TTGGAAAGTA GATGAGGAGC GGTTCAAGTC
CTGGAGGCAG GGAATGACAG GATACCCATT GGTAGATGCT GGCATGAGGG AACTTTGGGC TACCGGATGG ACACATAATC
GGATAAGAGT TATCATTTCA AGTTTTGCTG TGAAATTTCT ACTTATCCCA TGGACTTGGG GTATGAAGTA TTTTTGGGAT
GTGCTATTGG ATGCTGATCT GGAAAGTGAT ATTCTTGGTT GGCAGTACAT ATCTGGGAGC CTGCCTGATG GCCATGAGCT
CAGTCGTCTT GATAATCCAG AGGTATGCAG TCACTAAAGC ACAAAATCCT TTTTTTTTTT TTTTTTTTGC TATCAGGTAA
GCTTGATTAA GGCATGCTTG GTCTTTACCA CATTTTCGAT GGCCCTTGTG CAAAAATGTC GCTTGACACA GTATTTATGG
TAATCAAGTC ACCCACCACA CTTGGGACAT GAACCAAACT AGCCATACTT TATCGAATTT GCTTACATTG ATGTGGCAAA
CTGTGGCATT AAACTAAATA CAGGAATTTA GGAATTTCTC TTCATTAGAA AGTTCATATA TGATGAGACT AGAATAGATT
TTTATATCCA TGAAATTCTC CACAGATCAT CCACATTTCA CTATTCAGTT AAAAGGTGTT GAAGAGAAAC AGCTCAAGGA
AAACGTTAGT TAAAAGAATT CTGACTGTAG TGTAGTTACT AACCTAGGCA AACTTTTCCT GGCTTGGCTG AGGCATAAAA
CTGAGCTAGG ATTTGCACCC TTGGAGTGGG AAGCAAATGA TTTTTAGGTA TGCCACCTTA CTATTTGTTT TTCTATAAAA
TGCCATGTGC ACGTTTGTCA TACTCTCACT GAGTGGCATT CTAGAACTTT ACTTTATCAC AAATGGAGTG ACACTCAATC
AAGTAATTCT ACATAAAGAG CAAGCTGAAT TTTGTTTTTT CCCTCTAAAA GACAGTGGCT GCCAGGCCAA GCTTGCGAAC
CTAATTGTGT ACTGACGAGA TCATAGCCCA GCGGCCTCAG CCAACTTGAA AAATAACTTG GCATGGCCAG CATATGTTGC
CTTATTTTTT TTCCCTTTAA CAAGGGTCGA TATGATGAAA CTTAAATTGG CACAGATAGT ATATTTTGGT TATTGTAGTT
TGGTTTTCAT TGTTCTTGTA GATTATGGAA AATGTGATTG CTACGTATTA TGCCTTGTGC ATATGGTATT AATATATGTG
ATTTTACTGT TTCTGCCATC CACCCTACAA TTTTCCCTTG TCACTTGTAT AATGTATTGT CTATAATCAA AATTTTACGA
TATATGGTTT ACCTTGGCAC TTCCTACAGA TGCATTGACA AAACTTTGTG GCCTTCCTTT CTGCTTAGTT TTCAACTTGT
GATTTTTTGA AGTTTCACTG TACTATTAGG CAGAAGAGCT CCCTTGTGTT ATACTTATTT TATGTGTCTA AGTACCAAGT
GTTTTATCCA TGACATGCAA GATATTTATG TTTCCCTATT TGGCTTTTTT GATGCAAAAC TAGGTTCAAG GTCAAAAGTA
TGACCCAGAT GGTGTATATG TAAGAACTTG GATACCTGAA CTAGCTAGAA TGCCGACAGA ATGGATTCAT CATCCATGGG
ATGCACCGAG CTGTATTCTT GAAGTTGCTG GAGTTGAGCT GGGGTTTAAC TATCCTAAGC CAATCGTAGA CCTTCACATT
GCTAGGGAGT GTTTAGATGA TTCCATCTCC ACGATGTGGC AATTGGATAC AGCTGAGAAA CTTGCAGAAT TAGATGGTGA
GGTTGTGGAG GACAACTTGA GCAATATCAA GACTTTTGAC ATCCCAAAAG TTGTTTTGAG GGAAACATCT CCATGTGCTT
TGCCCATTGA TCAAAGAGTG CCCCATGCTA GCAGCAAGGA TCATAATTTA AAGTCAAAGG TATTGAAGGC CTCAAATAGA
AGTTCTATTT GTGTTGATAT GATCAGGTCC TCAAAGATGG AAGCAACGAG CTCTGTAGCA AACTCACCGG TATCAAGGAA
AAGATCCTTT TGTGAGACTG CATTTCATGT CCCATCTTAT TCATCTTCAG CTGAAGTGCA TTCGCATATT CAAGATCATG
GTGGTTCCTT AGTTGGGCCT TCAAGATATC TCCTGCAGGA AGCAGGTAGA AACTATGTTG ATGAGGTAAG CTTAATCATC
ATATTTGATA GACAAGTGCT GAAAAATTTA ATGCGATATT TTCATCTTTG TAGTTTTTTT TATCAGGAAA GCAAACATCC
CATGAAATTA CCACCACAAG ACCTATAAAC ATAATAACAT TCAACCTCCA AAGTACTAGG TTTAAAGTTT AAACAGCTTC
GAACACTCCA TGATATAGAT GGTATTCTGA AGTTGTGTCT TCTGCTTCTT TACAGCCAAC ATGAACTGTG TGGAGCGCCT
GTATCGTGAT CTTAGCTAAT CTTAATTCTG ACAACAGCTT CTGCTATAAT GACAAACTCA TGATATATTA TTGCTGCAAG
CTGACCAGCT TCTGTCGGCA TAAATGGCTT TATTGGATAA TCTAGGTGCT CAGGATGGGT AGTGGAAACC CACCCATTTC
ACACTTCCAC TGCTTCTAGA ACTAAGTCTA ACAAGTCTTG ATAGGATTAG TAAAACTGTG CAAGTCTTTG TAGTCAAATT
TCACGGCATG TATATTTCAG TAGATATTGC TGGAGGTAAA GCCTCCATCG AGAAACAAGA TAGCACCCAA CCTATGTTTA
ACTATGATAC TTTTTCTGGC 

Locus: Os02g0625000

Loading...

Locus: Os02g0625000

Loading...