Os02t0627100-01

Locus

Os02g0627100

Description

Phenylalanine ammonia-lyase, Broad spectrum disease resistance

RAP-DB Gene Symbol Synonym(s)

OsPAL4

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAL1

CGSNL Gene Name

PHENYLALANINE AMMONIA-LYASE 1

Oryzabase Gene Symbol Synonym(s)

OsPAL1, PAL, OsPAL06, ZB8, pal/zb8, PAL06, rPAL-P5, ZB8PAL, OsPAL, OsPAL2, OsPAL4, PAL4, PAL/ZB8, OsPAL6, PAL6

Oryzabase Gene Name Synonym(s)

phenylalanine ammonia-lyase 1, phenylalanine ammonia lyase

Transcript Evidence

AK068993

Protein Evidence

Q0DZE0

Literature

PMID: 25515696

Note

Manual Curation

July 20, 2020

Gene Ontology (GO)

Biological Process: L-phenylalanine catabolic process (GO:0006559)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: ammonia-lyase activity (GO:0016841)

Cellular Component: cytoplasm (GO:0005737)

Functional domain (InterPro)

Fumarase/histidase, N-terminal (IPR024083)

L-Aspartase-like (IPR008948)

Phenylalanine ammonia-lyase, shielding domain superfamily (IPR023144)

Aromatic amino acid lyase (IPR001106)

Phenylalanine ammonia-lyase (IPR005922)

Phenylalanine/histidine ammonia-lyases, active site (IPR022313)

Full-length cDNA

J023001A06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0627100-01)

RiceXPro (AK068993)

Others

Oryzabase (10463)

KEGG (Os02t0627100-01 (EC:4.3.1.24, EC:4.3.1.5))

Transcript

2405 bp

>Os02t0627100-01 Phenylalanine ammonia-lyase, Broad spectrum disease resistance
GCTAGGTTAACCGATCCATCTTCTGGTACTGAAATGGAGTGCGAGAACGGCCGCGTTTCT
GCCAATGGCATGAGTGGTCTCTGCGTCGCGGCGCCCCGCGCCGACCCGCTGAACTGGGGG
AAGGCCACGGAGGAGATGACGGGGAGCCACCTCGACGAGGTGAAGAGGATGGTGGCGGAG
TACCGCCAGCCTCTGGTCAAGATCGAGGGCGCTAGCCTGAGGATCGCGCAGGTCGCCGCG
GTGGCCGCGGCCGGCGAGGCCAGGGTGGAGCTCGACGAGTCGGCCCGCGAGCGCGTCAAG
GCCAGCAGCGACTGGGTGATGAACAGCATGATGAACGGCACGGACAGCTACGGTGTCACC
ACCGGTTTCGGCGCCACGTCCCACAGGAGGACCAAGGAGGGTGGTGCTCTGCAAAGAGAG
CTCATCAGATTCCTCAATGCCGGCGCGTTCGGCACTGGCACCGACGGTCATGTTTTGCCG
GCGGAGGCAACCCGCGCGGCAATGCTCGTCCGCATCAACACACTCCTCCAGGGATACTCC
GGCATCCGGTTCGAGATCCTCGAGGCGATCGCCAAGCTGCTCAACGCGAACGTCACACCG
TGCCTGCCGCTCCGGGGCACGATCACCGCCTCCGGTGACCTCGTCCCGCTGTCCTACATT
GCCGGCCTTGTCACTGGGCGCGAGAACGCCGTGGCGGTTGCACCAGATGGCAGCAAGGTG
AACGCCGCTGAGGCGTTCAAGATTGCTGGCATCCAGGGCGGCTTCTTCGAGCTGCAGCCC
AAGGAAGGCCTTGCCATGGTCAATGGCACTGCCGTGGGCTCTGGCCTTGCATCGACCGTG
CTCTTTGAGGCTAACATTCTTGCCATCCTCGCCGAGGTCCTCTCGGCCGTGTTCTGCGAG
GTGATGAACGGCAAGCCGGAGTACACCGACCACCTGACTCACAAGCTCAAGCACCATCCA
GGACAGATCGAGGCCGCCGCCATCATGGAGCACATCTTGGAGGGAAGCTCCTACATGAAG
CATGCCAAGAAGCTTGGTGAGCTCGACCCACTGATGAAGCCGAAGCAAGACCGGTACGCG
CTCCGGACATCCCCACAGTGGCTCGGCCCTCAAATTGAGGTTATCCGCGCCGCCACCAAG
TCCATCGAGCGTGAGATCAACTCCGTGAACGACAACCCGCTCATCGACGTCTCCCGCGGC
AAGGCGCTGCACGGTGGCAACTTCCAGGGCACGCCCATCGGCGTGTCCATGGACAACACC
CGCCTCGCCATCGCTGCCATCGGCAAGCTCATGTTCGCGCAGTTCTCGGAGCTCGTGAAC
GACTTCTACAACAACGGCCTGCCATCCAACCTGTCTGGCGGTCGCAACCCGAGCTTGGAC
TACGGGTTCAAGGGCGCCGAGATCGCCATGGCCTCCTACTGCTCCGAGCTGCAGTTCTTG
GGCAACCCAGTGACCAACCACGTCCAGAGCGCCGAGCAGCACAACCAGGACGTCAACTCT
CTTGGACTCATCTCCTCCAGGAAGACCGACGAGGCAATCGACATCCTGAAGCTCATGTCC
TCCACGTTCTTGATCGCCCTCTGCCAGGCCGTCGACCTGCGGCACATCGAGGAGAACGTC
AAGAGCGCCGTCAAGAGCTGCGTCATGACGGTGGCCAAGAAGACACTCAGCACCAACTCC
ACCGGCGATCTCCACGTCGCACGCTTCTGCGAGAAGGACCTGCTCAAGGAGATCGACCGC
GAGGCGGTGTTCGCGTACGCGGACGACCCGTGCAGCCACAACTACCCGCTGATGAAGAAG
CTGCGCAACGTGCTCGTGGAGCGCGCCCTCGCCAACGGCGCGGCCGAGTTCAACGCCGAC
ACCTCGGTGTTCGCCAAGGTCGCGCAGTTCGAGGAGGAGCTGCGCGCGACTCTGCCAGGT
GCGATCGAGGCCGCACGTGCGGCTGTGGAGAACGGCACGGCGGCGATTCCCAGCAGAATC
ACCGAGTGCAGGTCGTATCCGCTCTACCGGTTCGTGCGCGAGGAGCTCGGAACAAAGTAC
CTGACCGGCGAGAAGACACGATCGCCTGGCGAGGAGCTGAACAAGGTTCTTGTGGCTATC
AACGAAGGCAAGCACATCGACCCGTTGCTCGAGTGCCTCAAGGAGTGGAACGGCGAGCCC
CTGCCAATCTGCTGAACTAGTGAACCGATTAGCTGAATAACAGTGGAGTGTGGAGGCGTG
CGGTGTTGTTTTTATCTGGTGAATATTTTATTTTTACACTTATCTTTGTGTTACTCAAAA
GAATTCTTCGTTGCATAGCGGCAAGCATGCAACAGCAAAACTTGGTACGAGTGGCAGGTT
TCAAAAGCAACTAGTGTTGTAACATATAAGTTTTGGATATCAGAGTGTTGCAAATCATTA
ATTTT

CDS

2142 bp

>Os02t0627100-01 Phenylalanine ammonia-lyase, Broad spectrum disease resistance
ATGGAGTGCGAGAACGGCCGCGTTTCTGCCAATGGCATGAGTGGTCTCTGCGTCGCGGCG
CCCCGCGCCGACCCGCTGAACTGGGGGAAGGCCACGGAGGAGATGACGGGGAGCCACCTC
GACGAGGTGAAGAGGATGGTGGCGGAGTACCGCCAGCCTCTGGTCAAGATCGAGGGCGCT
AGCCTGAGGATCGCGCAGGTCGCCGCGGTGGCCGCGGCCGGCGAGGCCAGGGTGGAGCTC
GACGAGTCGGCCCGCGAGCGCGTCAAGGCCAGCAGCGACTGGGTGATGAACAGCATGATG
AACGGCACGGACAGCTACGGTGTCACCACCGGTTTCGGCGCCACGTCCCACAGGAGGACC
AAGGAGGGTGGTGCTCTGCAAAGAGAGCTCATCAGATTCCTCAATGCCGGCGCGTTCGGC
ACTGGCACCGACGGTCATGTTTTGCCGGCGGAGGCAACCCGCGCGGCAATGCTCGTCCGC
ATCAACACACTCCTCCAGGGATACTCCGGCATCCGGTTCGAGATCCTCGAGGCGATCGCC
AAGCTGCTCAACGCGAACGTCACACCGTGCCTGCCGCTCCGGGGCACGATCACCGCCTCC
GGTGACCTCGTCCCGCTGTCCTACATTGCCGGCCTTGTCACTGGGCGCGAGAACGCCGTG
GCGGTTGCACCAGATGGCAGCAAGGTGAACGCCGCTGAGGCGTTCAAGATTGCTGGCATC
CAGGGCGGCTTCTTCGAGCTGCAGCCCAAGGAAGGCCTTGCCATGGTCAATGGCACTGCC
GTGGGCTCTGGCCTTGCATCGACCGTGCTCTTTGAGGCTAACATTCTTGCCATCCTCGCC
GAGGTCCTCTCGGCCGTGTTCTGCGAGGTGATGAACGGCAAGCCGGAGTACACCGACCAC
CTGACTCACAAGCTCAAGCACCATCCAGGACAGATCGAGGCCGCCGCCATCATGGAGCAC
ATCTTGGAGGGAAGCTCCTACATGAAGCATGCCAAGAAGCTTGGTGAGCTCGACCCACTG
ATGAAGCCGAAGCAAGACCGGTACGCGCTCCGGACATCCCCACAGTGGCTCGGCCCTCAA
ATTGAGGTTATCCGCGCCGCCACCAAGTCCATCGAGCGTGAGATCAACTCCGTGAACGAC
AACCCGCTCATCGACGTCTCCCGCGGCAAGGCGCTGCACGGTGGCAACTTCCAGGGCACG
CCCATCGGCGTGTCCATGGACAACACCCGCCTCGCCATCGCTGCCATCGGCAAGCTCATG
TTCGCGCAGTTCTCGGAGCTCGTGAACGACTTCTACAACAACGGCCTGCCATCCAACCTG
TCTGGCGGTCGCAACCCGAGCTTGGACTACGGGTTCAAGGGCGCCGAGATCGCCATGGCC
TCCTACTGCTCCGAGCTGCAGTTCTTGGGCAACCCAGTGACCAACCACGTCCAGAGCGCC
GAGCAGCACAACCAGGACGTCAACTCTCTTGGACTCATCTCCTCCAGGAAGACCGACGAG
GCAATCGACATCCTGAAGCTCATGTCCTCCACGTTCTTGATCGCCCTCTGCCAGGCCGTC
GACCTGCGGCACATCGAGGAGAACGTCAAGAGCGCCGTCAAGAGCTGCGTCATGACGGTG
GCCAAGAAGACACTCAGCACCAACTCCACCGGCGATCTCCACGTCGCACGCTTCTGCGAG
AAGGACCTGCTCAAGGAGATCGACCGCGAGGCGGTGTTCGCGTACGCGGACGACCCGTGC
AGCCACAACTACCCGCTGATGAAGAAGCTGCGCAACGTGCTCGTGGAGCGCGCCCTCGCC
AACGGCGCGGCCGAGTTCAACGCCGACACCTCGGTGTTCGCCAAGGTCGCGCAGTTCGAG
GAGGAGCTGCGCGCGACTCTGCCAGGTGCGATCGAGGCCGCACGTGCGGCTGTGGAGAAC
GGCACGGCGGCGATTCCCAGCAGAATCACCGAGTGCAGGTCGTATCCGCTCTACCGGTTC
GTGCGCGAGGAGCTCGGAACAAAGTACCTGACCGGCGAGAAGACACGATCGCCTGGCGAG
GAGCTGAACAAGGTTCTTGTGGCTATCAACGAAGGCAAGCACATCGACCCGTTGCTCGAG
TGCCTCAAGGAGTGGAACGGCGAGCCCCTGCCAATCTGCTGA

Protein

714 aa

>Os02t0627100-01 Phenylalanine ammonia-lyase, Broad spectrum disease resistance
MECENGRVSANGMSGLCVAAPRADPLNWGKATEEMTGSHLDEVKRMVAEYRQPLVKIEGA
SLRIAQVAAVAAAGEARVELDESARERVKASSDWVMNSMMNGTDSYGVTTGFGATSHRRT
KEGGALQRELIRFLNAGAFGTGTDGHVLPAEATRAAMLVRINTLLQGYSGIRFEILEAIA
KLLNANVTPCLPLRGTITASGDLVPLSYIAGLVTGRENAVAVAPDGSKVNAAEAFKIAGI
QGGFFELQPKEGLAMVNGTAVGSGLASTVLFEANILAILAEVLSAVFCEVMNGKPEYTDH
LTHKLKHHPGQIEAAAIMEHILEGSSYMKHAKKLGELDPLMKPKQDRYALRTSPQWLGPQ
IEVIRAATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLAIAAIGKLM
FAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTNHVQSA
EQHNQDVNSLGLISSRKTDEAIDILKLMSSTFLIALCQAVDLRHIEENVKSAVKSCVMTV
AKKTLSTNSTGDLHVARFCEKDLLKEIDREAVFAYADDPCSHNYPLMKKLRNVLVERALA
NGAAEFNADTSVFAKVAQFEEELRATLPGAIEAARAAVENGTAAIPSRITECRSYPLYRF
VREELGTKYLTGEKTRSPGEELNKVLVAINEGKHIDPLLECLKEWNGEPLPIC*

5'UTR

chr02:25008986..25009018 (- strand) : 33 bp

CDS

chr02:25008591..25008985 (- strand) : 395 bp

chr02:25006725..25008471 (- strand) : 1747 bp

3'UTR

chr02:25006495..25006724 (- strand) : 230 bp

FASTA

>Os02t0627100-01 class=Sequence position=chr02:25006495..25009018 (- strand)
GCTAGGTTAA CCGATCCATC TTCTGGTACT GAAATGGAGT GCGAGAACGG CCGCGTTTCT GCCAATGGCA TGAGTGGTCT
CTGCGTCGCG GCGCCCCGCG CCGACCCGCT GAACTGGGGG AAGGCCACGG AGGAGATGAC GGGGAGCCAC CTCGACGAGG
TGAAGAGGAT GGTGGCGGAG TACCGCCAGC CTCTGGTCAA GATCGAGGGC GCTAGCCTGA GGATCGCGCA GGTCGCCGCG
GTGGCCGCGG CCGGCGAGGC CAGGGTGGAG CTCGACGAGT CGGCCCGCGA GCGCGTCAAG GCCAGCAGCG ACTGGGTGAT
GAACAGCATG ATGAACGGCA CGGACAGCTA CGGTGTCACC ACCGGTTTCG GCGCCACGTC CCACAGGAGG ACCAAGGAGG
GTGGTGCTCT GCAAAGAGAG CTCATCAGGT GAGGATTAGG ATTCCAAATA AGCAGTAACG TTTACCTGGT CACTGCGATT
AGTTCAGTTT ACTGTGCAAA TTCTTTGGAC GCCTTCTTAA TTATAAATTT GCTTGTTTTC TCGGCAGATT CCTCAATGCC
GGCGCGTTCG GCACTGGCAC CGACGGTCAT GTTTTGCCGG CGGAGGCAAC CCGCGCGGCA ATGCTCGTCC GCATCAACAC
ACTCCTCCAG GGATACTCCG GCATCCGGTT CGAGATCCTC GAGGCGATCG CCAAGCTGCT CAACGCGAAC GTCACACCGT
GCCTGCCGCT CCGGGGCACG ATCACCGCCT CCGGTGACCT CGTCCCGCTG TCCTACATTG CCGGCCTTGT CACTGGGCGC
GAGAACGCCG TGGCGGTTGC ACCAGATGGC AGCAAGGTGA ACGCCGCTGA GGCGTTCAAG ATTGCTGGCA TCCAGGGCGG
CTTCTTCGAG CTGCAGCCCA AGGAAGGCCT TGCCATGGTC AATGGCACTG CCGTGGGCTC TGGCCTTGCA TCGACCGTGC
TCTTTGAGGC TAACATTCTT GCCATCCTCG CCGAGGTCCT CTCGGCCGTG TTCTGCGAGG TGATGAACGG CAAGCCGGAG
TACACCGACC ACCTGACTCA CAAGCTCAAG CACCATCCAG GACAGATCGA GGCCGCCGCC ATCATGGAGC ACATCTTGGA
GGGAAGCTCC TACATGAAGC ATGCCAAGAA GCTTGGTGAG CTCGACCCAC TGATGAAGCC GAAGCAAGAC CGGTACGCGC
TCCGGACATC CCCACAGTGG CTCGGCCCTC AAATTGAGGT TATCCGCGCC GCCACCAAGT CCATCGAGCG TGAGATCAAC
TCCGTGAACG ACAACCCGCT CATCGACGTC TCCCGCGGCA AGGCGCTGCA CGGTGGCAAC TTCCAGGGCA CGCCCATCGG
CGTGTCCATG GACAACACCC GCCTCGCCAT CGCTGCCATC GGCAAGCTCA TGTTCGCGCA GTTCTCGGAG CTCGTGAACG
ACTTCTACAA CAACGGCCTG CCATCCAACC TGTCTGGCGG TCGCAACCCG AGCTTGGACT ACGGGTTCAA GGGCGCCGAG
ATCGCCATGG CCTCCTACTG CTCCGAGCTG CAGTTCTTGG GCAACCCAGT GACCAACCAC GTCCAGAGCG CCGAGCAGCA
CAACCAGGAC GTCAACTCTC TTGGACTCAT CTCCTCCAGG AAGACCGACG AGGCAATCGA CATCCTGAAG CTCATGTCCT
CCACGTTCTT GATCGCCCTC TGCCAGGCCG TCGACCTGCG GCACATCGAG GAGAACGTCA AGAGCGCCGT CAAGAGCTGC
GTCATGACGG TGGCCAAGAA GACACTCAGC ACCAACTCCA CCGGCGATCT CCACGTCGCA CGCTTCTGCG AGAAGGACCT
GCTCAAGGAG ATCGACCGCG AGGCGGTGTT CGCGTACGCG GACGACCCGT GCAGCCACAA CTACCCGCTG ATGAAGAAGC
TGCGCAACGT GCTCGTGGAG CGCGCCCTCG CCAACGGCGC GGCCGAGTTC AACGCCGACA CCTCGGTGTT CGCCAAGGTC
GCGCAGTTCG AGGAGGAGCT GCGCGCGACT CTGCCAGGTG CGATCGAGGC CGCACGTGCG GCTGTGGAGA ACGGCACGGC
GGCGATTCCC AGCAGAATCA CCGAGTGCAG GTCGTATCCG CTCTACCGGT TCGTGCGCGA GGAGCTCGGA ACAAAGTACC
TGACCGGCGA GAAGACACGA TCGCCTGGCG AGGAGCTGAA CAAGGTTCTT GTGGCTATCA ACGAAGGCAA GCACATCGAC
CCGTTGCTCG AGTGCCTCAA GGAGTGGAAC GGCGAGCCCC TGCCAATCTG CTGAACTAGT GAACCGATTA GCTGAATAAC
AGTGGAGTGT GGAGGCGTGC GGTGTTGTTT TTATCTGGTG AATATTTTAT TTTTACACTT ATCTTTGTGT TACTCAAAAG
AATTCTTCGT TGCATAGCGG CAAGCATGCA ACAGCAAAAC TTGGTACGAG TGGCAGGTTT CAAAAGCAAC TAGTGTTGTA
ACATATAAGT TTTGGATATC AGAGTGTTGC AAATCATTAA TTTT

Locus: Os02g0627100

Loading...

Locus: Os02g0627100

Loading...