Os02t0631700-01

Locus

Os02g0631700

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR11, OsRR11, Rra8, OsRRA8

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 11, A-TYPE response regulator 11, A-type RR 8

CGSNL Gene Symbol

RR11

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 11

Oryzabase Gene Symbol Synonym(s)

OsRR11, Rra8, OsRRA8, RR8

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 11, A-type RR 8

Transcript Evidence

AB249656 (Genbank)

BR000318 (Genbank)

Protein Evidence

Q6H468 (UniProt)

Literature

PMID: 16919402

PMID: 17293362

Note

Manual Curation

May 11, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Expression Databases

TENOR (Os02t0631700-01)

Others

Oryzabase (8156)

Transcript

444 bp

>Os02t0631700-01 A-type response regulator, Cytokinin signaling
ATGTCGTCGATCGGCGCCGGCGCAGGAGGAGCCGTGGTGGGGGCGGCCGTGGCGGCGGTG
GCGGTGGGCGGCGGGGCGCCGCCGCACGTCCTCGCCGTGGACGACAGCTCGGTCGACCGC
GCCGTCATCGCCGGCATCCTCCGGAGCTCCCGGTTTCGTGTGACGGCTGTGGATAGCGGG
AAGAGGGCCCTGGAACTGCTAGGCTCGGAACCAAATGTGAGCATGATAATCACGGACTAC
TGGATGCCGGAGATGACGGGATACGAGCTCCTGAAGAAAGTCAAGGAGTCATCCAAGCTG
AAGAAGATCCCCGTGGTGATCATGTCCTCGGAGAATGTGCCAACAAGAATCAGCAGATGC
CTTGAGGAAGGCGCGGAGGATTTCTTGGTGAAGCCCGTCCGGCCATCCGACGTGTCGCGG
CTCTTCAGCCGCGTGCTACCATGA

CDS

444 bp

>Os02t0631700-01 A-type response regulator, Cytokinin signaling
ATGTCGTCGATCGGCGCCGGCGCAGGAGGAGCCGTGGTGGGGGCGGCCGTGGCGGCGGTG
GCGGTGGGCGGCGGGGCGCCGCCGCACGTCCTCGCCGTGGACGACAGCTCGGTCGACCGC
GCCGTCATCGCCGGCATCCTCCGGAGCTCCCGGTTTCGTGTGACGGCTGTGGATAGCGGG
AAGAGGGCCCTGGAACTGCTAGGCTCGGAACCAAATGTGAGCATGATAATCACGGACTAC
TGGATGCCGGAGATGACGGGATACGAGCTCCTGAAGAAAGTCAAGGAGTCATCCAAGCTG
AAGAAGATCCCCGTGGTGATCATGTCCTCGGAGAATGTGCCAACAAGAATCAGCAGATGC
CTTGAGGAAGGCGCGGAGGATTTCTTGGTGAAGCCCGTCCGGCCATCCGACGTGTCGCGG
CTCTTCAGCCGCGTGCTACCATGA

Protein

148 aa

>Os02t0631700-01 A-type response regulator, Cytokinin signaling
MSSIGAGAGGAVVGAAVAAVAVGGGAPPHVLAVDDSSVDRAVIAGILRSSRFRVTAVDSG
KRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSKLKKIPVVIMSSENVPTRISRC
LEEGAEDFLVKPVRPSDVSRLFSRVLP*

CDS

chr02:25287683..25287842 (- strand) : 160 bp

chr02:25287542..25287588 (- strand) : 47 bp

chr02:25287354..25287431 (- strand) : 78 bp

chr02:25287179..25287249 (- strand) : 71 bp

chr02:25286967..25287054 (- strand) : 88 bp

FASTA

>Os02t0631700-01 class=Sequence position=chr02:25286967..25287842 (- strand)
ATGTCGTCGA TCGGCGCCGG CGCAGGAGGA GCCGTGGTGG GGGCGGCCGT GGCGGCGGTG GCGGTGGGCG GCGGGGCGCC
GCCGCACGTC CTCGCCGTGG ACGACAGCTC GGTCGACCGC GCCGTCATCG CCGGCATCCT CCGGAGCTCC CGGTTTCGTG
GTACATGTGT GGTTGATGCA TATCAGTTTT GTTTTTTGTT CTGTTTGTGG TTGCTGCTGT TGAAAATGTT GTTTTGGACG
TTTTTCTGGT GCAGTGACGG CTGTGGATAG CGGGAAGAGG GCCCTGGAAC TGCTAGGCTC GGTACGCCTT TGTTTTTTTC
CTGAACTTTT GGCCTTGTTT TGCATGTCAG GTTGCGGTGA TATGCAGCCG CAATTTTCTC ATGTTCCTTT GGCTCGCTCA
TCATCTTGCA GGAACCAAAT GTGAGCATGA TAATCACGGA CTACTGGATG CCGGAGATGA CGGGATACGA GCTCCTGAAG
AAAGTCAAGG TATACATGCA TGATCTTAGA TTGTCCTGCA GAAAGCTTAA TTACTTTGAT TAACAGGAGA ATCAATCTGA
CGACGCAAAA TCATGAATCG TATATGCATG CAGGAGTCAT CCAAGCTGAA GAAGATCCCC GTGGTGATCA TGTCCTCGGA
GAATGTGCCA ACAAGAATCA GCAGGTATTT TTATCCGTTT ATAATATCTC TATTGATTAG AGCATTCTTA TGTCTTATCC
ATACAGATTA CCGAGCACTT AACCATTGTT CTTCCATCTT TGCTCTGTTC GATTGGTTTA TTAACCAGAT GCCTTGAGGA
AGGCGCGGAG GATTTCTTGG TGAAGCCCGT CCGGCCATCC GACGTGTCGC GGCTCTTCAG CCGCGTGCTA CCATGA

Locus: Os02g0631700

Loading...

Locus: Os02g0631700

Loading...