Os02t0633300-01

Locus

Os02g0633300

Description

EspB-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YSL14

CGSNL Gene Name

YELLOW STRIP-LIKE GENE 14

Oryzabase Gene Symbol Synonym(s)

OsYSL14, OsYs5

Oryzabase Gene Name Synonym(s)

rice YSL (yellow stripe-like) gene 14, Probable metal-nicotianamine transporter YSL14, Protein YELLOW STRIPE LIKE 14, yellow stripe 1-like transporter 14

Transcript Evidence

AK058249 (DDBJ, Best hit)

Protein Evidence

C0PHI2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

001-012-B08 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0633300-01)

RiceXPro (AK058249)

Others

Oryzabase (8355)

KEGG (Os02t0633300-01)

Transcript

822 bp

>Os02t0633300-01 EspB-like protein.
tgctatcttcgtgttcggagcgtgggcgggcctttctcacggtggtgtgctcgtaggact
tgccgcttgcggtgtcatgatgagcatcgtgtcgactgcctctgacctgatgcaagactt
caagactggatacttgactctggcatcaccgaggtccatgtttatcagccaggtgatcgg
caccgggatgggctgtgtcatagctccctgtgtcttctggctcttctacaaggcCTTCAG
CAATATTGGCACAAGCGGCACCGAGTACCCGGCGCCATATGCCATCGTGTACCGCAACAT
GGCCATCCTGGGTGTCGATGGCTTCAACTCGCTTCCGGAGAACTGCCTCACTCTCTGCTA
CATCTTCTTCGCCGCGGCGATCGCCATCAACCTGATCAGAGACCTGGCGCCGCACAAGGT
CTCCAGGTTCATCCCGCTCCCCATGGCAATGGCGATCCCTTTCTACATTGGATCGTACTT
CGCGATCGATATGTTCCTGGGCAGCGTGATCCTCTTTGTGTGGGAGAAGCTGAACAAGGC
CAAGGCGGATGCGTTTGGACCTGCGGTGGCGTCAGGGTTGATCTGCGGTGATGGGATCTG
GACTCTTCCCCAGTCCATTCTTGCCCTTGCCAAGGTGAAGCCCCCCATTTGCATGAAATT
TTTGTCGAGGGCAGCCAATGCCAAAGTGGATAGCTTCCTTGCCGGTTAGTCGTGCCATCG
TGATCAATTGATCTTTGAAGAGAACATTTGCAAGGAGTGCGCGCCATCCTGTAATTATCT
CCTCCAAATGTATTTCCAGATCACTTGTTTTGTAGAAAAGCC

CDS

708 bp

>Os02t0633300-01 EspB-like protein.
gctatcttcgtgttcggagcgtgggcgggcctttctcacggtggtgtgctcgtaggactt
gccgcttgcggtgtcatgatgagcatcgtgtcgactgcctctgacctgatgcaagacttc
aagactggatacttgactctggcatcaccgaggtccatgtttatcagccaggtgatcggc
accgggatgggctgtgtcatagctccctgtgtcttctggctcttctacaaggcCTTCAGC
AATATTGGCACAAGCGGCACCGAGTACCCGGCGCCATATGCCATCGTGTACCGCAACATG
GCCATCCTGGGTGTCGATGGCTTCAACTCGCTTCCGGAGAACTGCCTCACTCTCTGCTAC
ATCTTCTTCGCCGCGGCGATCGCCATCAACCTGATCAGAGACCTGGCGCCGCACAAGGTC
TCCAGGTTCATCCCGCTCCCCATGGCAATGGCGATCCCTTTCTACATTGGATCGTACTTC
GCGATCGATATGTTCCTGGGCAGCGTGATCCTCTTTGTGTGGGAGAAGCTGAACAAGGCC
AAGGCGGATGCGTTTGGACCTGCGGTGGCGTCAGGGTTGATCTGCGGTGATGGGATCTGG
ACTCTTCCCCAGTCCATTCTTGCCCTTGCCAAGGTGAAGCCCCCCATTTGCATGAAATTT
TTGTCGAGGGCAGCCAATGCCAAAGTGGATAGCTTCCTTGCCGGTTAG

Protein

235 aa

>Os02t0633300-01 EspB-like protein.
AIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFISQVIG
TGMGCVIAPCVFWLFYKAFSNIGTSGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCY
IFFAAAIAINLIRDLAPHKVSRFIPLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKA
KADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLSRAANAKVDSFLAG*

5'UTR

chr02:25403237..25403237 (+ strand) : 1 bp

CDS

chr02:25403238..25403945 (+ strand) : 708 bp

3'UTR

chr02:25403946..25404058 (+ strand) : 113 bp

FASTA

>Os02t0633300-01 class=Sequence position=chr02:25403237..25404058 (+ strand)
tgctatcttc gtgttcggag cgtgggcggg cctttctcac ggtggtgtgc tcgtaggact tgccgcttgc ggtgtcatga
tgagcatcgt gtcgactgcc tctgacctga tgcaagactt caagactgga tacttgactc tggcatcacc gaggtccatg
tttatcagcc aggtgatcgg caccgggatg ggctgtgtca tagctccctg tgtcttctgg ctcttctaca aggcCTTCAG
CAATATTGGC ACAAGCGGCA CCGAGTACCC GGCGCCATAT GCCATCGTGT ACCGCAACAT GGCCATCCTG GGTGTCGATG
GCTTCAACTC GCTTCCGGAG AACTGCCTCA CTCTCTGCTA CATCTTCTTC GCCGCGGCGA TCGCCATCAA CCTGATCAGA
GACCTGGCGC CGCACAAGGT CTCCAGGTTC ATCCCGCTCC CCATGGCAAT GGCGATCCCT TTCTACATTG GATCGTACTT
CGCGATCGAT ATGTTCCTGG GCAGCGTGAT CCTCTTTGTG TGGGAGAAGC TGAACAAGGC CAAGGCGGAT GCGTTTGGAC
CTGCGGTGGC GTCAGGGTTG ATCTGCGGTG ATGGGATCTG GACTCTTCCC CAGTCCATTC TTGCCCTTGC CAAGGTGAAG
CCCCCCATTT GCATGAAATT TTTGTCGAGG GCAGCCAATG CCAAAGTGGA TAGCTTCCTT GCCGGTTAGT CGTGCCATCG
TGATCAATTG ATCTTTGAAG AGAACATTTG CAAGGAGTGC GCGCCATCCT GTAATTATCT CCTCCAAATG TATTTCCAGA
TCACTTGTTT TGTAGAAAAG CC

Locus: Os02g0633300

Loading...

Locus: Os02g0633300

Loading...