Os02t0646400-01

Locus

Os02g0646400

Description

Similar to Glutaredoxin.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GRX10

CGSNL Gene Name

GLUTAREDOXIN 10

Oryzabase Gene Symbol Synonym(s)

OsGRX10

Oryzabase Gene Name Synonym(s)

glutaredoxin 10

Transcript Evidence

AK067828 (DDBJ, Best hit)

Protein Evidence

Q6H628 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell redox homeostasis (GO:0045454)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)

Functional domain (InterPro)

Glutaredoxin (IPR002109)

Glutaredoxin, eukaryotic/virial (IPR011899)

Thioredoxin-like fold (IPR012336)

Glutaredoxin subgroup (IPR014025)

Full-length cDNA

J013120N01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0646400-01)

RiceXPro (AK067828)

Others

Oryzabase (13586)

KEGG (Os02t0646400-01)

Transcript

789 bp

>Os02t0646400-01 Similar to Glutaredoxin.
GAGCGAAACCACCACGGAAAGATCTCCCCAGTCCACACGTCGAAATCGATCGAAATCGAG
GGGGCCGGAGATGGCTGCGGCGAGAGCAGCGGTCCCCATCGCCGTCTTCCTCCTCCTCGT
CCTCGCCGAGGCCGACCCCGCGGCGGCGACGCGCTCGCCTTCGGCCTTCGTGCAGAACGC
CATCTACTCCAATCGCATCACCATCTTCTCTAAAACCTACTGCCCGTACTCTATGCGTGC
TAAGCGTATATTTAGAGATCTCAAGGAGAATCCTTATATTGTTGAACTAGATCTCAGAGA
GGATGGTAGAGAAATTCAAAGTGTTCTTCTAGACTTAGTTGGCCGTCATACTGTGCCACA
GGTGTTCGTGAATGGCCAGCACGTTGGTGGCTCAGATGATACAGCAAATGCTCATTCTAA
TGGACAGCTTCAGAAACTTCTTGGAAATAGCCAATCACAGCGATGATCTGTAGTTAAGAC
TATCAAATACTCGTGTATGGCTAACATGTGTGAGAAGAAGGGGGCCGTCTTTTCTCTTTA
CACAGGATCCTTAACAGAATGTTGCAGCTTCAGCAGTTTTTTTTGCATGGAAGTGTTGTG
ACAACGATTTCTATGTTTGTGATTCATCTGTCAAGCGCATATTCTATTAACTGCTGTGCC
GGCTCTGTACTGTTTGTGACTTTGTGTTTATAAGTTATTAATTCCCCTTGTATTTACAAT
GACTATCAATAATAGGTAGTGCGGCTATGGTTTGTGTAAGTACTTGAATTTAGTTGACTT
TTGGTGATG

CDS

396 bp

>Os02t0646400-01 Similar to Glutaredoxin.
ATGGCTGCGGCGAGAGCAGCGGTCCCCATCGCCGTCTTCCTCCTCCTCGTCCTCGCCGAG
GCCGACCCCGCGGCGGCGACGCGCTCGCCTTCGGCCTTCGTGCAGAACGCCATCTACTCC
AATCGCATCACCATCTTCTCTAAAACCTACTGCCCGTACTCTATGCGTGCTAAGCGTATA
TTTAGAGATCTCAAGGAGAATCCTTATATTGTTGAACTAGATCTCAGAGAGGATGGTAGA
GAAATTCAAAGTGTTCTTCTAGACTTAGTTGGCCGTCATACTGTGCCACAGGTGTTCGTG
AATGGCCAGCACGTTGGTGGCTCAGATGATACAGCAAATGCTCATTCTAATGGACAGCTT
CAGAAACTTCTTGGAAATAGCCAATCACAGCGATGA

Protein

132 aa

>Os02t0646400-01 Similar to Glutaredoxin.
MAAARAAVPIAVFLLLVLAEADPAAATRSPSAFVQNAIYSNRITIFSKTYCPYSMRAKRI
FRDLKENPYIVELDLREDGREIQSVLLDLVGRHTVPQVFVNGQHVGGSDDTANAHSNGQL
QKLLGNSQSQR*

5'UTR

chr02:26031530..26031599 (+ strand) : 70 bp

CDS

chr02:26031600..26031754 (+ strand) : 155 bp

chr02:26033161..26033234 (+ strand) : 74 bp

chr02:26033326..26033424 (+ strand) : 99 bp

chr02:26033510..26033577 (+ strand) : 68 bp

3'UTR

chr02:26033578..26033900 (+ strand) : 323 bp

FASTA

>Os02t0646400-01 class=Sequence position=chr02:26031530..26033900 (+ strand)
GAGCGAAACC ACCACGGAAA GATCTCCCCA GTCCACACGT CGAAATCGAT CGAAATCGAG GGGGCCGGAG ATGGCTGCGG
CGAGAGCAGC GGTCCCCATC GCCGTCTTCC TCCTCCTCGT CCTCGCCGAG GCCGACCCCG CGGCGGCGAC GCGCTCGCCT
TCGGCCTTCG TGCAGAACGC CATCTACTCC AATCGCATCA CCATCTTCTC TAAAACCTAC TGCCCGTAAG CCCTCCAGGA
CGCCCCTTTA CACGGCTCCT TTCACCTGTT TTTCTGGTTG GATTTTGGGG GAATTTTTCA GGGATGTGCG TGTGCTTGAT
GGTGAGGAGT GGCAGGAGTA GATGCCGCAG CGAGGAGATC TCCGGGAATA GAGAACGGGT TCATATACCG TGAATTAGGG
TGGATTTGTT GTGCAGTAGA TGGTGTAGTG CGAATTAGGA AGATTTGCCC TGCAATTGGA ACCCAGATTG TTGAGAAATA
GCTTAATTTA AGTTAAATTG AGCTTGTGAA CTGTGGTCGG ATAGTTTTAT TTGACGGAAT TTGAACATTT TGTTTGCTTA
GAACTGAAAA TAGTTACCAA ACTGTCCATA TACGAGTAGT TTTTATTCAA ACTGTTGAAT AGATCCAGCT ATGCCTTGGT
TTGCTAGATT TAACTCTATG ATGTAGTATA GTCCCCACTA CACCCCCTCT GGGCAGTACA AAGCCCTGGT GAATTTTGTG
GAATGTATTT CAGGTAAGTT CTCTTTACAT TTTTTTGGAA GATCTTTACA TATTTCTGTC GAGTCTTTAA AACAAAATAA
AATGGTTTGA CCTACTGATA CAATAGAGAA GTCTTAATAC AGAGGGGGTA TCCTACTCGA ATTGCTGTCT GCGTACTGCA
CATTGTGCTT CTGTAACATA TGGTCTAAGA TAACCTATAG GTTGAGATTA TCCTACTGGA GTACTAGGAG CGGCAATAGT
GGACTCATAA AGTATCTTGT ACTATTGTAC CATGTGGTTA AACTAGTTAG TACCCTCAAA TCAACTGGCA TTAATTGGTT
TGTTTCTTGG GTAGCAACGG GTTGTTTTTA ATGGAGTAGT AAACAATCTG TGTCTACACA TTTGTCCACA CACACATGCT
ATTATAATGC TTGCATATTT GTATCACTCC TAAGGTGTAT TACAGATTTA CAGTTGGGCT ATAATCCACC AATTAGAAGA
ATGTGGTGTC CATGTGTTTA TATGCAGTGT ACATGTGTTA CCCTAGCATA TTAATTTGTA ACATGGTTCC TTCCTATTAT
TGAAGCAAAC CATCTGGTGG GATAAAAAAT TGTGAAGTTC GTTTTTGGGA TATATATGTG TGTTTTAATA TAACAAAATT
AAAAGACATT TAACTGTGAC TGTACAAAGT GAATACAAGG ATGCAGTTCA TTGTTGAAAT TTGCATGATT GTATTTGTAT
ACCAAATTAA GGATGAATTC TGAATCACAA GAAACCAAGG AGTCGAAGAC TGAGTGGTTG AATTACTAGA TCTTTTGTTC
TCCTTGAAAT ATCCTAAACA CTTCTTATAT GGCACGACTA ATGAATTCTC CTGTAACTGT ACCACTCCTG ACATCTTCTT
CTCAAATGCC TCTTTACTCT TGTTCTTCTA GGTACTCTAT GCGTGCTAAG CGTATATTTA GAGATCTCAA GGAGAATCCT
TATATTGTTG AACTAGATCT CAGAGGTAAT CATCTTGGTC TCATGGAGCC TGAATCAAAT TTCAATTCAT TCATTTGACA
GCTTGAAGTT AATAGTACTC TATACATGCT ATGCAGAGGA TGGTAGAGAA ATTCAAAGTG TTCTTCTAGA CTTAGTTGGC
CGTCATACTG TGCCACAGGT GTTCGTGAAT GGCCAGCACG TTGGTGGCTC AGATGGTTAG TGTTTTATGC TGCACTGTTG
TTTCTATGTA AGCATGTACA CTTCCATAAA TATCAACAAT CTGCTTGCTG AATATTACAG ATACAGCAAA TGCTCATTCT
AATGGACAGC TTCAGAAACT TCTTGGAAAT AGCCAATCAC AGCGATGATC TGTAGTTAAG ACTATCAAAT ACTCGTGTAT
GGCTAACATG TGTGAGAAGA AGGGGGCCGT CTTTTCTCTT TACACAGGAT CCTTAACAGA ATGTTGCAGC TTCAGCAGTT
TTTTTTGCAT GGAAGTGTTG TGACAACGAT TTCTATGTTT GTGATTCATC TGTCAAGCGC ATATTCTATT AACTGCTGTG
CCGGCTCTGT ACTGTTTGTG ACTTTGTGTT TATAAGTTAT TAATTCCCCT TGTATTTACA ATGACTATCA ATAATAGGTA
GTGCGGCTAT GGTTTGTGTA AGTACTTGAA TTTAGTTGAC TTTTGGTGAT G

Locus: Os02g0646400

Loading...

Locus: Os02g0646400

Loading...