Os02t0647900-01

Locus

Os02g0647900

Description

Similar to Fatty aldehyde dehydrogenase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH3E2

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 3E2

Oryzabase Gene Symbol Synonym(s)

OsALDH3E2

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 3E2

Transcript Evidence

AK120274 (DDBJ, Best hit)

AK060824 (DDBJ, Best hit)

Protein Evidence

B8AG13 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellular aldehyde metabolic process (GO:0006081)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: aldehyde dehydrogenase [NAD(P)+] activity (GO:0004030)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase NAD(P)-dependent (IPR012394)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J013048F01 (Online Clone Ordering)

001-034-B04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0647900-01)

RiceXPro (AK120274)

Others

Oryzabase (22112)

KEGG (Os02t0647900-01)

Transcript

1949 bp

>Os02t0647900-01 Similar to Fatty aldehyde dehydrogenase 1.
GATCAGGCCAAATCGCCTGCAATAATTCTCTCGCCGTGTAACAACAACACACGCGCCAGC
CGAGAGAAACCAAACACTAGACCCCCACCACGAGTTCACGACGTGCACGAGCGAGCGAGC
TAGAAAAGCAAGCGAGAGCGAGCGCATGGCCCCGGCAATGGTAGCCGCCATGGGAGAGAA
GCCGAAGCCCGCAGTCGTGTTGGGCGGCATGGTGAGCGGGCTGAGGGAGGTGTACGAGAG
CGGGAGGACCAAGGACCTGGAGTGGAGGCAGTCGCAGCTCAAGGCGCTCATCAGGCTCCT
CACCGACAAGGAGGAGGAGATCTTCGCCGTCCTCCACGACGACCTCGGCAAGCACCGCGG
CGAGTCGTTCCGAGACGAGCTTGGGATTCTTGTCAAGTCGATCAAGTACACGCTGCAAAA
CCTCAAGAAATGGGCGGCTTCGGAGAGGGCGGAATCGCCGTTGGTTGCATTCCCTGCGAC
CGCGATGGTGGTGCCGGAGCCGCTCGGTGTCGTGCTCGTTTTCTCCTGCTGGAATCTGCC
ACTAGGCTTAGCGTTGGAGCCACTCTCCGGCGCCATAGCGGCCGGCAACGCCGTTGTTCT
GAAGCCCTCCGAGCTCGCGCCGTCCACCGCCGCGTTCCTCGCCGCCAACATCCCGAGGTA
TCTGGACAGCAGGGCAGTGAAGGTCGTCCTGGGAGGCCCCAATGTTGGAGAGGAACTCAT
GGAGCACAGATGGGACAAGGTTCTTTTCACCGGGAGTGCCAGAATAGGACGCATTATCAT
GGCTAAAGCAGTCAAACACTTGACCCCGGTTGCACTTGAACTGGGTTCGAAATGCCCATG
CATCGTTGATTGGCTGGACAGTAAGAGGGATAGGCAGATTGCGGTGAACCGCATAATCGG
AGCGAAATGGTCGACTTGTGCTGGTCAGGCTTGCATCGCCATCGATCACGTAATCGTCGA
GGAGAGATTTGCACCGATTCTGATTGAGCTACTGAAATCAACTCTTAAGAGGTTCATGGC
CAAACCGGGTGGCATGGCCCGTATCCTGAACGCAAAACATTTTGAGAGGTTGAGTGGCTA
TCTGGAGGATAATAGGGTGGCAGCTTCTGTAGTGCACGGTGGTTACATGGACCCCAAGAA
ACTGAATATTGAGCCAACCTTACTGCTAAATCCTCCTGCTGATTCTGATGTCATGACCGA
GGAGGTATTTGGCCCGATTCTCCCAATCATCACGGTAAAGAAGATCGAGGATTGCATCGC
GTATTTAAAGTCCAAGCCGAAACCGATTGCGATGTACGCCTTCACCAACAACGAGAGGCT
GAAACGCCGGATCGTAGAGGAAACGTCGTCCGGGAGTGTCACATTCAACGACGCAGTTGT
GCAGTACGCTCTTGAAAGCGTCCCTTTCGGCGGAGTTGGCCATAGCGGATTCGGACAGTA
CCACGGCAAGTACTCATTCGAGCTGTTCAGCCACAAGAAGGCGGTGTTCAAGAGAAGCTT
TCTGATCGAGTTCATGTTCAGATACCCACCATGGGATGAGAGAAAGATCGGGACGCTGAG
GCACGTCTTCAGCTATAACTACTTCTTGCTGTTCTTCAACCTGCTCGGCTTTAGGAGATG
AAGAAGCCAGCCGAAGAAAGATTTCGGCTGTGAAGAAGTAAGCAGAGAAAGAAGCTACTA
CTATATAGTAGTATATAGTAGTAGTAATATACTACAGCTAAACACGTGGATTATATACGG
TTCTACCTTGTGTGATGTGATAATGTATCACTATACTTCAGTTGCATATTGTATTGTCAC
GTTCTATGCTCTTATTTATTGTACTCTTTGGAAAGAAAGGGAGGGATTGTTTTATTTTTT
TTAAAAAAATGACTAGTGGAAATAGGGTGCTCCGACATGTTATACATAAAAGAAGATATG
TAAAGAGTTTAAGGGTGCTTTGGATCCTC

CDS

1476 bp

>Os02t0647900-01 Similar to Fatty aldehyde dehydrogenase 1.
ATGGCCCCGGCAATGGTAGCCGCCATGGGAGAGAAGCCGAAGCCCGCAGTCGTGTTGGGC
GGCATGGTGAGCGGGCTGAGGGAGGTGTACGAGAGCGGGAGGACCAAGGACCTGGAGTGG
AGGCAGTCGCAGCTCAAGGCGCTCATCAGGCTCCTCACCGACAAGGAGGAGGAGATCTTC
GCCGTCCTCCACGACGACCTCGGCAAGCACCGCGGCGAGTCGTTCCGAGACGAGCTTGGG
ATTCTTGTCAAGTCGATCAAGTACACGCTGCAAAACCTCAAGAAATGGGCGGCTTCGGAG
AGGGCGGAATCGCCGTTGGTTGCATTCCCTGCGACCGCGATGGTGGTGCCGGAGCCGCTC
GGTGTCGTGCTCGTTTTCTCCTGCTGGAATCTGCCACTAGGCTTAGCGTTGGAGCCACTC
TCCGGCGCCATAGCGGCCGGCAACGCCGTTGTTCTGAAGCCCTCCGAGCTCGCGCCGTCC
ACCGCCGCGTTCCTCGCCGCCAACATCCCGAGGTATCTGGACAGCAGGGCAGTGAAGGTC
GTCCTGGGAGGCCCCAATGTTGGAGAGGAACTCATGGAGCACAGATGGGACAAGGTTCTT
TTCACCGGGAGTGCCAGAATAGGACGCATTATCATGGCTAAAGCAGTCAAACACTTGACC
CCGGTTGCACTTGAACTGGGTTCGAAATGCCCATGCATCGTTGATTGGCTGGACAGTAAG
AGGGATAGGCAGATTGCGGTGAACCGCATAATCGGAGCGAAATGGTCGACTTGTGCTGGT
CAGGCTTGCATCGCCATCGATCACGTAATCGTCGAGGAGAGATTTGCACCGATTCTGATT
GAGCTACTGAAATCAACTCTTAAGAGGTTCATGGCCAAACCGGGTGGCATGGCCCGTATC
CTGAACGCAAAACATTTTGAGAGGTTGAGTGGCTATCTGGAGGATAATAGGGTGGCAGCT
TCTGTAGTGCACGGTGGTTACATGGACCCCAAGAAACTGAATATTGAGCCAACCTTACTG
CTAAATCCTCCTGCTGATTCTGATGTCATGACCGAGGAGGTATTTGGCCCGATTCTCCCA
ATCATCACGGTAAAGAAGATCGAGGATTGCATCGCGTATTTAAAGTCCAAGCCGAAACCG
ATTGCGATGTACGCCTTCACCAACAACGAGAGGCTGAAACGCCGGATCGTAGAGGAAACG
TCGTCCGGGAGTGTCACATTCAACGACGCAGTTGTGCAGTACGCTCTTGAAAGCGTCCCT
TTCGGCGGAGTTGGCCATAGCGGATTCGGACAGTACCACGGCAAGTACTCATTCGAGCTG
TTCAGCCACAAGAAGGCGGTGTTCAAGAGAAGCTTTCTGATCGAGTTCATGTTCAGATAC
CCACCATGGGATGAGAGAAAGATCGGGACGCTGAGGCACGTCTTCAGCTATAACTACTTC
TTGCTGTTCTTCAACCTGCTCGGCTTTAGGAGATGA

Protein

492 aa

>Os02t0647900-01 Similar to Fatty aldehyde dehydrogenase 1.
MAPAMVAAMGEKPKPAVVLGGMVSGLREVYESGRTKDLEWRQSQLKALIRLLTDKEEEIF
AVLHDDLGKHRGESFRDELGILVKSIKYTLQNLKKWAASERAESPLVAFPATAMVVPEPL
GVVLVFSCWNLPLGLALEPLSGAIAAGNAVVLKPSELAPSTAAFLAANIPRYLDSRAVKV
VLGGPNVGEELMEHRWDKVLFTGSARIGRIIMAKAVKHLTPVALELGSKCPCIVDWLDSK
RDRQIAVNRIIGAKWSTCAGQACIAIDHVIVEERFAPILIELLKSTLKRFMAKPGGMARI
LNAKHFERLSGYLEDNRVAASVVHGGYMDPKKLNIEPTLLLNPPADSDVMTEEVFGPILP
IITVKKIEDCIAYLKSKPKPIAMYAFTNNERLKRRIVEETSSGSVTFNDAVVQYALESVP
FGGVGHSGFGQYHGKYSFELFSHKKAVFKRSFLIEFMFRYPPWDERKIGTLRHVFSYNYF
LLFFNLLGFRR*

5'UTR

chr02:26079797..26079941 (+ strand) : 145 bp

CDS

chr02:26079942..26080175 (+ strand) : 234 bp

chr02:26080295..26080363 (+ strand) : 69 bp

chr02:26080470..26080566 (+ strand) : 97 bp

chr02:26083479..26083685 (+ strand) : 207 bp

chr02:26083818..26083942 (+ strand) : 125 bp

chr02:26084039..26084143 (+ strand) : 105 bp

chr02:26084247..26084407 (+ strand) : 161 bp

chr02:26084484..26084574 (+ strand) : 91 bp

chr02:26084668..26084817 (+ strand) : 150 bp

chr02:26084903..26085139 (+ strand) : 237 bp

3'UTR

chr02:26085140..26085467 (+ strand) : 328 bp

FASTA

>Os02t0647900-01 class=Sequence position=chr02:26079797..26085467 (+ strand)
GATCAGGCCA AATCGCCTGC AATAATTCTC TCGCCGTGTA ACAACAACAC ACGCGCCAGC CGAGAGAAAC CAAACACTAG
ACCCCCACCA CGAGTTCACG ACGTGCACGA GCGAGCGAGC TAGAAAAGCA AGCGAGAGCG AGCGCATGGC CCCGGCAATG
GTAGCCGCCA TGGGAGAGAA GCCGAAGCCC GCAGTCGTGT TGGGCGGCAT GGTGAGCGGG CTGAGGGAGG TGTACGAGAG
CGGGAGGACC AAGGACCTGG AGTGGAGGCA GTCGCAGCTC AAGGCGCTCA TCAGGCTCCT CACCGACAAG GAGGAGGAGA
TCTTCGCCGT CCTCCACGAC GACCTCGGCA AGCACCGCGG CGAGTCGTTC CGAGACGAGG TGACGATCGA GCGAGTCACC
GCCGACACGT TTACTAATCC GTCCCATGCA TGCATGCTTT GGTCTCTCTG CATTTGGTTT ATAAGCTGGT ATATGGTTTT
TGTATGTACC GTCTTCAGCT TGGGATTCTT GTCAAGTCGA TCAAGTACAC GCTGCAAAAC CTCAAGAAAT GGGCGGCTTC
GGAGAGGGTG AGCAGTAAGC TCGTGCAGTG TTACATCTGC ATGCATTTCA GACAGGTACT AGCTCTTGTT ACCATGGCTG
TGGCCTCCTA CGCTGTGCTT TTGTTTGCTG TAGGCGGAAT CGCCGTTGGT TGCATTCCCT GCGACCGCGA TGGTGGTGCC
GGAGCCGCTC GGTGTCGTGC TCGTTTTCTC CTGCTGGAAT CTGCCACTAG GTGAAGTGAA ATAAACCCTA TACTCTGTTC
TGTTCTAGAA GAAGCAGAAA TCTCTCGGTA GCAAGTTCTC TAGAGTTATA TTTTGCCATA ATGGCCAAAA GGTGTCTGTT
AAATCACAAA TAAACTCCCT TGCCCACTTG CCCGCCCGAA AATCAGGGAC TGGCACGTTG TTATCATGTT GGATATGCAT
CATCTCACGG TATTAATTGC CTCGTGGATT AAGTTATTAT TACACTCCAC TCAACCTACC AGAACCCATT ACGAAGCAGT
GAAGACGACT CTGTATCGAC AGGAACGTGC GTGGTTGTAA CGACAAATCA CGTTATTTCG ATACAGGTTA ATCACGGGTC
ACAATACTAT GTAGATTGAT TTGATATATA TCTAACCGAC TCATACGGGC AATTGAGACA ATTTGGTATC ACACGGGGTT
GTTATCAGTT GCACTCATCA CCCTTGGGTG TTCACAAGAT GATGTATTGA TGTGGTCCAG AAATCTGTAA CACTGTTCAT
CGCAGCACTG TACCAGAAGA ATtactccct ccgtcccaca acaagcaaac cgtggattcc cgtgttaacg tttaattgtc
cgtcttatat gatttttttt ataattagta ttttcattgt tgttagatga taaaacatga ttaatatttt atgcatgact
tatcttttta attttttata acttttttaa ataagacgaa cagtcaaaca ttggaaacgg aaatcaaggt ttgtcttttt
ttttggacgg aaggagtatg tagatagagc tgtgacggtt actgtaggtC AAATGTTTAG ACGTTGATGC CCCTGATCTG
ACAGCTGGGA AATGGAATGC ACTCCATGGT TACCCTAAAT GCAGATATAT TGTAGAAAAA CAAAATTTAT ACTATTTTTC
TCAtcctaaa atataacaac ctatgataat attagactta tcctaaacca tgaatttgga cataccgtat gataaattcg
ttgtgttagg ataagtttaa tcccattcta aattgttact atattttaaa acggagggag taGAAAGTTT TATAAATGCT
TGGCTAATGA AGTTAGTTGA ATTGAATTGC TCGTACTTTC TCATGAACTT AAGTTTTTAA GCGAGTTGGC TAATAGTCCA
TGATGCACGT TAATATGGTA TTAGAGTCAG GCATGGAATT CATATGATAG CTGATGTGAT TAAATGAAAA ACTTGAAGCT
CTTCCATTCC ATGTATTATA Agagcaagtt taatagtaca atcaactact agctccaaat catttgtaat caatttaata
gctaattcat acaataagaa catataaacg tatactacac tattagcaca tagtcccacc tgccatacat acattttgtc
taggagcccg tgctgcagct agcaacaaat ttgtagcccg ctgctcatct ctcttttttt atttccttga tatgtgttta
tagctggcat atagcctggt attgtacctg ctcTAAGGTA CAACATCCAC ATGATTCATG TGGAGTTTTG AAGTGAACCG
TTGGCTCTCT CTCATTAGCT CAAGTTTTTT GGTTGACTTG GTTGACGCAT GTActccatc cgtcccaaaa tataagcatt
tttagcatag tgataagtca aacattttca actttgacta ttaatagcaa aaaaaaatat aaaagatcaa tcatgtaaat
ttgatgttac ctagatttat cattaaacaa actatcataa tatgtaacta tttttattta aaacatttta cttttataga
tattgttagt caaagtagta tcttagagac cgtatcaaag ttcaaaaatg cttatatttt aggacggaag gagTAGCTTC
ATAAACACTT TTGAAGCTTC ATATACTAAA TGATTCAAAA TGTAGATGGG TCTCAACTAC TTTTTTTTTG CGCAAATCAA
ACAATACCTC TTGAATTCTA ATAAAATTTT TAAAGAAAGA AAGTTTCTGT TGTAAATGAA TGTAGTACTC TGTATAGAAA
ATATGTAAGA ATTCAACATT TCGAATTGGA CCTCAATTTC AAATTTAGGA TTACAAATAA AAACTATGCA TTTCAACTGG
GGTGTTACTG TGTCAGGGTC TTTACTCCTT AGGATTTGTT TGGGTGGGCC TCCGTCCTAG CTCATCCACA TGGATGGGTG
GATTGGACCA GGACTAAACC CATCCAATCG AGGCCTCGTG GAGACAAATT AACGGTTTAT TGTCTATTTC ATATTTCCCT
CGTCCAGAGA AAGTAGTACC TCGCCTACTT AAATTTACAA GAGAAAAAAA AGGGTGGAAA TAATGCAATA TGGTTCAGAT
TCTTTAAAGC TTTGTTTTTT TAAAAAAATA CTATATGATC CAAATATAGA TTCAATAGAA CAATACACAT TATTGCAGTT
AGTTGGGTAG TTAAAAAAAT TAATGTGATT TCTCCTGCTT CTCGAGGAGT TGAACATAAA TATGATAACC CCCGCAAATA
AAAGTATGta ctccctccat ttcatattat aagtcgtttg gttttttctc tagtcaaact tttttaagtt tgattaaatt
tgtgaaaaaa tataatagta ttttttaact caagataaac atattatcaa aatatatgta atgttagatt taatgaaact
aattatatat tttagatgtt actaattttt ttataaactt agttaaactt aataaaattt aacttaaaaa aaagtcaaac
gacttataat atgaaaATTG TAAACGGATG TAGTAACGCT TAATTGTACT GTATTTAATT TAAGGATATT CCGTCACCAG
TGTCACCAAA CTAAATTAAT GGAATCATGC CCACTGCACT AAATCTGGCC ATTCTCCGTG TGTCCGTACG CTCTGTCTGC
AGGCTTAGCG TTGGAGCCAC TCTCCGGCGC CATAGCGGCC GGCAACGCCG TTGTTCTGAA GCCCTCCGAG CTCGCGCCGT
CCACCGCCGC GTTCCTCGCC GCCAACATCC CGAGGTATCT GGACAGCAGG GCAGTGAAGG TCGTCCTGGG AGGCCCCAAT
GTTGGAGAGG AACTCATGGA GCACAGATGG GACAAGGTTC TTTTCACCGG TAGTACAAAT TCCATTGCCT GCAAAATCAC
CTCTAATTTG TTTCTCTTCT CACCATTTTT CAGACGGAAA AGTTATGTAA ATCTAGTTGT TCTCAATGCA TATCTAATGG
TCGTTTCTTG GGTTTGATCA GGGAGTGCCA GAATAGGACG CATTATCATG GCTAAAGCAG TCAAACACTT GACCCCGGTT
GCACTTGAAC TGGGTTCGAA ATGCCCATGC ATCGTTGATT GGCTGGACAG TAAGAGGGAT AGGCAGGTAG AATCCTCAAT
TTCTCATCAA TATTCAGTTT CGCTGCAGTA TACAGTCACA CTGTAGGACA GGTTGACAGT GTCCCGTACA CCAATGACAC
AGATTGCGGT GAACCGCATA ATCGGAGCGA AATGGTCGAC TTGTGCTGGT CAGGCTTGCA TCGCCATCGA TCACGTAATC
GTCGAGGAGA GATTTGCACC GATTCTGGTC TGGTTCATCA TTCTGAATCC TACGCAGTAA AACTTCTTGC CATACAAACA
CCGTGACTTA CAATGTCTCT TCTTGCACAT TTTTTTTCTG TTATCTGTAG ATTGAGCTAC TGAAATCAAC TCTTAAGAGG
TTCATGGCCA AACCGGGTGG CATGGCCCGT ATCCTGAACG CAAAACATTT TGAGAGGTTG AGTGGCTATC TGGAGGATAA
TAGGGTGGCA GCTTCTGTAG TGCACGGTGG TTACATGGAC CCCAAGAAAC TGTAAGTTCT GAAAACCTGT TGGCCAAGCG
TCTGCACACA ATTGGTCCCG CACGATTTCA TTCCCAATTG CTTGCAGGAA TATTGAGCCA ACCTTACTGC TAAATCCTCC
TGCTGATTCT GATGTCATGA CCGAGGAGGT ATTTGGCCCG ATTCTCCCAA TCATCACGGT ACGCACTGAC AACGATTGCA
TAGTTTCTGG GTGGATGATT TCACATACAT CTGCAACCTA CGACTGAACC AATTTGATCA TCCGTTTGCA GGTAAAGAAG
ATCGAGGATT GCATCGCGTA TTTAAAGTCC AAGCCGAAAC CGATTGCGAT GTACGCCTTC ACCAACAACG AGAGGCTGAA
ACGCCGGATC GTAGAGGAAA CGTCGTCCGG GAGTGTCACA TTCAACGACG CAGTTGTGCA GGTATGCACG GCCACACACC
CCGTTTCAGA GCTAAAACTG TACCGCAGTA AAATTCTCAT CGTTTTTTGC CACTGTCATG TTGTAGTACG CTCTTGAAAG
CGTCCCTTTC GGCGGAGTTG GCCATAGCGG ATTCGGACAG TACCACGGCA AGTACTCATT CGAGCTGTTC AGCCACAAGA
AGGCGGTGTT CAAGAGAAGC TTTCTGATCG AGTTCATGTT CAGATACCCA CCATGGGATG AGAGAAAGAT CGGGACGCTG
AGGCACGTCT TCAGCTATAA CTACTTCTTG CTGTTCTTCA ACCTGCTCGG CTTTAGGAGA TGAAGAAGCC AGCCGAAGAA
AGATTTCGGC TGTGAAGAAG TAAGCAGAGA AAGAAGCTAC TACTATATAG TAGTATATAG TAGTAGTAAT ATACTACAGC
TAAACACGTG GATTATATAC GGTTCTACCT TGTGTGATGT GATAATGTAT CACTATACTT CAGTTGCATA TTGTATTGTC
ACGTTCTATG CTCTTATTTA TTGTACTCTT TGGAAAGAAA GGGAGGGATT GTTTTATTTT TTTTAAAAAA ATGACTAGTG
GAAATAGGGT GCTCCGACAT GTTATACATA AAAGAAGATA TGTAAAGAGT TTAAGGGTGC TTTGGATCCT C

Locus: Os02g0647900

Loading...

Locus: Os02g0647900

Loading...