Os02t0647900-02

Locus

Os02g0647900

Description

Similar to aldehyde dehydrogenase 3B1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH3E2

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 3E2

Oryzabase Gene Symbol Synonym(s)

OsALDH3E2

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 3E2

Transcript Evidence

AK099790 (DDBJ, Best hit)

Protein Evidence

B8AG13 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellular aldehyde metabolic process (GO:0006081)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: aldehyde dehydrogenase [NAD(P)+] activity (GO:0004030)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase NAD(P)-dependent (IPR012394)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J013097B22 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0647900-02)

RiceXPro (AK099790)

Others

Oryzabase (22112)

KEGG (Os02t0647900-02 (EC:1.2.1.5))

Transcript

1314 bp

>Os02t0647900-02 Similar to aldehyde dehydrogenase 3B1.
GTTTTCTCCTGCTGGAATCTGCCACTAGGCTTAGCGTTGGAGCCACTCTCCGGCGCCATA
GCGGCCGGCAACGCCGTTGTTCTGAAGCCCTCCGAGCTCGCGCCGTCCACCGCCGCGTTC
CTCGCCGCCAACATCCCGAGGTATCTGGACAGCAGGGCAGTGAAGGTCGTCCTGGGAGGC
CCCAATGTTGGAGAGGAACTCATGGAGCACAGATGGGACAAGGTTCTTTTCACCGGGAGT
GCCAGAATAGGACGCATTATCATGGCTAAAGCAGTCAAACACTTGACCCCGGTTGCACTT
GAACTGGGTTCGAAATGCCCATGCATCGTTGATTGGCTGGACAGTAAGAGGGATAGGCAG
ATTGCGGTGAACCGCATAATCGGAGCGAAATGGTCGACTTGTGCTGGTCAGGCTTGCATC
GCCATCGATCACGTAATCGTCGAGGAGAGATTTGCACCGATTCTGATTGAGCTACTGAAA
TCAACTCTTAAGAGGTTCATGGCCAAACCGGGTGGCATGGCCCGTATCCTGAACGCAAAA
CATTTTGAGAGGTTGAGTGGCTATCTGGAGGATAATAGGGTGGCAGCTTCTGTAGTGCAC
GGTGGTTACATGGACCCCAAGAAACTGAATATTGAGCCAACCTTACTGCTAAATCCTCCT
GCTGATTCTGATGTCATGACCGAGGAGGTATTTGGCCCGATTCTCCCAATCATCACGGTA
AAGAAGATCGAGGATTGCATCGCGTATTTAAAGTCCAAGCCGAAACCGATTGCGATGTAC
GCCTTCACCAACAACGAGAGGCTGAAACGCCGGATCGTAGAGGAAACGTCGTCCGGGAGT
GTCACATTCAACGACGCAGTTGTGCAGTACGCTCTTGAAAGCGTCCCTTTCGGCGGAGTT
GGCCATAGCGGATTCGGACAGTACCACGGCAAGTACTCATTCGAGCTGTTCAGCCACAAG
AAGGCGGTGTTCAAGAGAAGCTTTCTGATCGAGTTCATGTTCAGATACCCACCATGGGAT
GAGAGAAAGATCGGGACGCTGAGGCACGTCTTCAGCTATAACTACTTCTTGCTGTTCTTC
AACCTGCTCGGCTTTAGGAGATGAAGAAGCCAGCCGAAGAAAGATTTCGGCTGTGAAGAA
GTAAGCAGAGAAAGAAGCTACTACTATATAGTAGTATATAGTAGTAGTAATATACTACAG
CTAAACACGTGGATTATATACGGTTCTACCTTGTGTGATGTGATAATGTATCACTATACT
TCAGTTGCATATTGTATTGTCACGTTCTATGCTCTTATTTATTGTACTCTTTGG

CDS

1104 bp

>Os02t0647900-02 Similar to aldehyde dehydrogenase 3B1.
GTTTTCTCCTGCTGGAATCTGCCACTAGGCTTAGCGTTGGAGCCACTCTCCGGCGCCATA
GCGGCCGGCAACGCCGTTGTTCTGAAGCCCTCCGAGCTCGCGCCGTCCACCGCCGCGTTC
CTCGCCGCCAACATCCCGAGGTATCTGGACAGCAGGGCAGTGAAGGTCGTCCTGGGAGGC
CCCAATGTTGGAGAGGAACTCATGGAGCACAGATGGGACAAGGTTCTTTTCACCGGGAGT
GCCAGAATAGGACGCATTATCATGGCTAAAGCAGTCAAACACTTGACCCCGGTTGCACTT
GAACTGGGTTCGAAATGCCCATGCATCGTTGATTGGCTGGACAGTAAGAGGGATAGGCAG
ATTGCGGTGAACCGCATAATCGGAGCGAAATGGTCGACTTGTGCTGGTCAGGCTTGCATC
GCCATCGATCACGTAATCGTCGAGGAGAGATTTGCACCGATTCTGATTGAGCTACTGAAA
TCAACTCTTAAGAGGTTCATGGCCAAACCGGGTGGCATGGCCCGTATCCTGAACGCAAAA
CATTTTGAGAGGTTGAGTGGCTATCTGGAGGATAATAGGGTGGCAGCTTCTGTAGTGCAC
GGTGGTTACATGGACCCCAAGAAACTGAATATTGAGCCAACCTTACTGCTAAATCCTCCT
GCTGATTCTGATGTCATGACCGAGGAGGTATTTGGCCCGATTCTCCCAATCATCACGGTA
AAGAAGATCGAGGATTGCATCGCGTATTTAAAGTCCAAGCCGAAACCGATTGCGATGTAC
GCCTTCACCAACAACGAGAGGCTGAAACGCCGGATCGTAGAGGAAACGTCGTCCGGGAGT
GTCACATTCAACGACGCAGTTGTGCAGTACGCTCTTGAAAGCGTCCCTTTCGGCGGAGTT
GGCCATAGCGGATTCGGACAGTACCACGGCAAGTACTCATTCGAGCTGTTCAGCCACAAG
AAGGCGGTGTTCAAGAGAAGCTTTCTGATCGAGTTCATGTTCAGATACCCACCATGGGAT
GAGAGAAAGATCGGGACGCTGAGGCACGTCTTCAGCTATAACTACTTCTTGCTGTTCTTC
AACCTGCTCGGCTTTAGGAGATGA

Protein

368 aa

>Os02t0647900-02 Similar to aldehyde dehydrogenase 3B1.
VFSCWNLPLGLALEPLSGAIAAGNAVVLKPSELAPSTAAFLAANIPRYLDSRAVKVVLGG
PNVGEELMEHRWDKVLFTGSARIGRIIMAKAVKHLTPVALELGSKCPCIVDWLDSKRDRQ
IAVNRIIGAKWSTCAGQACIAIDHVIVEERFAPILIELLKSTLKRFMAKPGGMARILNAK
HFERLSGYLEDNRVAASVVHGGYMDPKKLNIEPTLLLNPPADSDVMTEEVFGPILPIITV
KKIEDCIAYLKSKPKPIAMYAFTNNERLKRRIVEETSSGSVTFNDAVVQYALESVPFGGV
GHSGFGQYHGKYSFELFSHKKAVFKRSFLIEFMFRYPPWDERKIGTLRHVFSYNYFLLFF
NLLGFRR*

CDS

chr02:26080539..26080566 (+ strand) : 28 bp

chr02:26083479..26083685 (+ strand) : 207 bp

chr02:26083818..26083942 (+ strand) : 125 bp

chr02:26084039..26084143 (+ strand) : 105 bp

chr02:26084247..26084407 (+ strand) : 161 bp

chr02:26084484..26084574 (+ strand) : 91 bp

chr02:26084668..26084817 (+ strand) : 150 bp

chr02:26084903..26085139 (+ strand) : 237 bp

3'UTR

chr02:26085140..26085349 (+ strand) : 210 bp

FASTA

>Os02t0647900-02 class=Sequence position=chr02:26080539..26085349 (+ strand)
GTTTTCTCCT GCTGGAATCT GCCACTAGGT GAAGTGAAAT AAACCCTATA CTCTGTTCTG TTCTAGAAGA AGCAGAAATC
TCTCGGTAGC AAGTTCTCTA GAGTTATATT TTGCCATAAT GGCCAAAAGG TGTCTGTTAA ATCACAAATA AACTCCCTTG
CCCACTTGCC CGCCCGAAAA TCAGGGACTG GCACGTTGTT ATCATGTTGG ATATGCATCA TCTCACGGTA TTAATTGCCT
CGTGGATTAA GTTATTATTA CACTCCACTC AACCTACCAG AACCCATTAC GAAGCAGTGA AGACGACTCT GTATCGACAG
GAACGTGCGT GGTTGTAACG ACAAATCACG TTATTTCGAT ACAGGTTAAT CACGGGTCAC AATACTATGT AGATTGATTT
GATATATATC TAACCGACTC ATACGGGCAA TTGAGACAAT TTGGTATCAC ACGGGGTTGT TATCAGTTGC ACTCATCACC
CTTGGGTGTT CACAAGATGA TGTATTGATG TGGTCCAGAA ATCTGTAACA CTGTTCATCG CAGCACTGTA CCAGAAGAAT
tactccctcc gtcccacaac aagcaaaccg tggattcccg tgttaacgtt taattgtccg tcttatatga ttttttttat
aattagtatt ttcattgttg ttagatgata aaacatgatt aatattttat gcatgactta tctttttaat tttttataac
ttttttaaat aagacgaaca gtcaaacatt ggaaacggaa atcaaggttt gtcttttttt ttggacggaa ggagtatgta
gatagagctg tgacggttac tgtaggtCAA ATGTTTAGAC GTTGATGCCC CTGATCTGAC AGCTGGGAAA TGGAATGCAC
TCCATGGTTA CCCTAAATGC AGATATATTG TAGAAAAACA AAATTTATAC TATTTTTCTC Atcctaaaat ataacaacct
atgataatat tagacttatc ctaaaccatg aatttggaca taccgtatga taaattcgtt gtgttaggat aagtttaatc
ccattctaaa ttgttactat attttaaaac ggagggagta GAAAGTTTTA TAAATGCTTG GCTAATGAAG TTAGTTGAAT
TGAATTGCTC GTACTTTCTC ATGAACTTAA GTTTTTAAGC GAGTTGGCTA ATAGTCCATG ATGCACGTTA ATATGGTATT
AGAGTCAGGC ATGGAATTCA TATGATAGCT GATGTGATTA AATGAAAAAC TTGAAGCTCT TCCATTCCAT GTATTATAAg
agcaagttta atagtacaat caactactag ctccaaatca tttgtaatca atttaatagc taattcatac aataagaaca
tataaacgta tactacacta ttagcacata gtcccacctg ccatacatac attttgtcta ggagcccgtg ctgcagctag
caacaaattt gtagcccgct gctcatctct ctttttttat ttccttgata tgtgtttata gctggcatat agcctggtat
tgtacctgct cTAAGGTACA ACATCCACAT GATTCATGTG GAGTTTTGAA GTGAACCGTT GGCTCTCTCT CATTAGCTCA
AGTTTTTTGG TTGACTTGGT TGACGCATGT Actccatccg tcccaaaata taagcatttt tagcatagtg ataagtcaaa
cattttcaac tttgactatt aatagcaaaa aaaaatataa aagatcaatc atgtaaattt gatgttacct agatttatca
ttaaacaaac tatcataata tgtaactatt tttatttaaa acattttact tttatagata ttgttagtca aagtagtatc
ttagagaccg tatcaaagtt caaaaatgct tatattttag gacggaagga gTAGCTTCAT AAACACTTTT GAAGCTTCAT
ATACTAAATG ATTCAAAATG TAGATGGGTC TCAACTACTT TTTTTTTGCG CAAATCAAAC AATACCTCTT GAATTCTAAT
AAAATTTTTA AAGAAAGAAA GTTTCTGTTG TAAATGAATG TAGTACTCTG TATAGAAAAT ATGTAAGAAT TCAACATTTC
GAATTGGACC TCAATTTCAA ATTTAGGATT ACAAATAAAA ACTATGCATT TCAACTGGGG TGTTACTGTG TCAGGGTCTT
TACTCCTTAG GATTTGTTTG GGTGGGCCTC CGTCCTAGCT CATCCACATG GATGGGTGGA TTGGACCAGG ACTAAACCCA
TCCAATCGAG GCCTCGTGGA GACAAATTAA CGGTTTATTG TCTATTTCAT ATTTCCCTCG TCCAGAGAAA GTAGTACCTC
GCCTACTTAA ATTTACAAGA GAAAAAAAAG GGTGGAAATA ATGCAATATG GTTCAGATTC TTTAAAGCTT TGTTTTTTTA
AAAAAATACT ATATGATCCA AATATAGATT CAATAGAACA ATACACATTA TTGCAGTTAG TTGGGTAGTT AAAAAAATTA
ATGTGATTTC TCCTGCTTCT CGAGGAGTTG AACATAAATA TGATAACCCC CGCAAATAAA AGTATGtact ccctccattt
catattataa gtcgtttggt tttttctcta gtcaaacttt tttaagtttg attaaatttg tgaaaaaata taatagtatt
ttttaactca agataaacat attatcaaaa tatatgtaat gttagattta atgaaactaa ttatatattt tagatgttac
taattttttt ataaacttag ttaaacttaa taaaatttaa cttaaaaaaa agtcaaacga cttataatat gaaaATTGTA
AACGGATGTA GTAACGCTTA ATTGTACTGT ATTTAATTTA AGGATATTCC GTCACCAGTG TCACCAAACT AAATTAATGG
AATCATGCCC ACTGCACTAA ATCTGGCCAT TCTCCGTGTG TCCGTACGCT CTGTCTGCAG GCTTAGCGTT GGAGCCACTC
TCCGGCGCCA TAGCGGCCGG CAACGCCGTT GTTCTGAAGC CCTCCGAGCT CGCGCCGTCC ACCGCCGCGT TCCTCGCCGC
CAACATCCCG AGGTATCTGG ACAGCAGGGC AGTGAAGGTC GTCCTGGGAG GCCCCAATGT TGGAGAGGAA CTCATGGAGC
ACAGATGGGA CAAGGTTCTT TTCACCGGTA GTACAAATTC CATTGCCTGC AAAATCACCT CTAATTTGTT TCTCTTCTCA
CCATTTTTCA GACGGAAAAG TTATGTAAAT CTAGTTGTTC TCAATGCATA TCTAATGGTC GTTTCTTGGG TTTGATCAGG
GAGTGCCAGA ATAGGACGCA TTATCATGGC TAAAGCAGTC AAACACTTGA CCCCGGTTGC ACTTGAACTG GGTTCGAAAT
GCCCATGCAT CGTTGATTGG CTGGACAGTA AGAGGGATAG GCAGGTAGAA TCCTCAATTT CTCATCAATA TTCAGTTTCG
CTGCAGTATA CAGTCACACT GTAGGACAGG TTGACAGTGT CCCGTACACC AATGACACAG ATTGCGGTGA ACCGCATAAT
CGGAGCGAAA TGGTCGACTT GTGCTGGTCA GGCTTGCATC GCCATCGATC ACGTAATCGT CGAGGAGAGA TTTGCACCGA
TTCTGGTCTG GTTCATCATT CTGAATCCTA CGCAGTAAAA CTTCTTGCCA TACAAACACC GTGACTTACA ATGTCTCTTC
TTGCACATTT TTTTTCTGTT ATCTGTAGAT TGAGCTACTG AAATCAACTC TTAAGAGGTT CATGGCCAAA CCGGGTGGCA
TGGCCCGTAT CCTGAACGCA AAACATTTTG AGAGGTTGAG TGGCTATCTG GAGGATAATA GGGTGGCAGC TTCTGTAGTG
CACGGTGGTT ACATGGACCC CAAGAAACTG TAAGTTCTGA AAACCTGTTG GCCAAGCGTC TGCACACAAT TGGTCCCGCA
CGATTTCATT CCCAATTGCT TGCAGGAATA TTGAGCCAAC CTTACTGCTA AATCCTCCTG CTGATTCTGA TGTCATGACC
GAGGAGGTAT TTGGCCCGAT TCTCCCAATC ATCACGGTAC GCACTGACAA CGATTGCATA GTTTCTGGGT GGATGATTTC
ACATACATCT GCAACCTACG ACTGAACCAA TTTGATCATC CGTTTGCAGG TAAAGAAGAT CGAGGATTGC ATCGCGTATT
TAAAGTCCAA GCCGAAACCG ATTGCGATGT ACGCCTTCAC CAACAACGAG AGGCTGAAAC GCCGGATCGT AGAGGAAACG
TCGTCCGGGA GTGTCACATT CAACGACGCA GTTGTGCAGG TATGCACGGC CACACACCCC GTTTCAGAGC TAAAACTGTA
CCGCAGTAAA ATTCTCATCG TTTTTTGCCA CTGTCATGTT GTAGTACGCT CTTGAAAGCG TCCCTTTCGG CGGAGTTGGC
CATAGCGGAT TCGGACAGTA CCACGGCAAG TACTCATTCG AGCTGTTCAG CCACAAGAAG GCGGTGTTCA AGAGAAGCTT
TCTGATCGAG TTCATGTTCA GATACCCACC ATGGGATGAG AGAAAGATCG GGACGCTGAG GCACGTCTTC AGCTATAACT
ACTTCTTGCT GTTCTTCAAC CTGCTCGGCT TTAGGAGATG AAGAAGCCAG CCGAAGAAAG ATTTCGGCTG TGAAGAAGTA
AGCAGAGAAA GAAGCTACTA CTATATAGTA GTATATAGTA GTAGTAATAT ACTACAGCTA AACACGTGGA TTATATACGG
TTCTACCTTG TGTGATGTGA TAATGTATCA CTATACTTCA GTTGCATATT GTATTGTCAC GTTCTATGCT CTTATTTATT
GTACTCTTTG G

Locus: Os02g0647900

Loading...

Locus: Os02g0647900

Loading...