Os02t0649300-01

Locus

Os02g0649300

Description

HD-ZIP I protein, Transcription activator, Stress response, Panicle development

RAP-DB Gene Symbol Synonym(s)

HOX24, Oshox24, OsHox24, OsSLI1

RAP-DB Gene Name Synonym(s)

HOMEOBOX GENE 24, rice homeobox gene 24, Homeobox-leucine zipper protein HOX24, Homeodomain transcription factor HOX24, HD-ZIP protein HOX24, stress largely induced 1

CGSNL Gene Symbol

HOX24

CGSNL Gene Name

HOMEOBOX GENE 24

Oryzabase Gene Symbol Synonym(s)

Oshox24, OsHox24, OsSLI1

Oryzabase Gene Name Synonym(s)

rice homeobox gene 24, Homeobox-leucine zipper protein HOX24, Homeodomain transcription factor HOX24, HD-ZIP protein HOX24, stress largely induced 1

Transcript Evidence

AK063685

Protein Evidence

Q6H6S3

Literature

PMID: 25089296

PMID: 17999151

Note

Manual Curation

July 9, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeodomain-like (IPR009057)

Homeobox domain (IPR001356)

Leucine zipper, homeobox-associated (IPR003106)

Helix-turn-helix motif (IPR000047)

Homeobox, conserved site (IPR017970)

Full-length cDNA

001-119-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0649300-01)

Others

Oryzabase (8461)

Transcript

1332 bp

>Os02t0649300-01 HD-ZIP I protein, Transcription activator, Stress response, Panicle development
GAACACACACACTACTGCGACTGCTAGTGCTCTGGTCTTACATTCGACGAACTGATCGAT
ATTCGATACGACGTCTCCTCCTACCTGGAGCTTGGGAAAAATGGAGAGCGACTGCCAGTT
CTTGGTGGCGCCGCCGCAGCCGCACATGTACTACGACACGGCGGCGGCGGCGGTGGACGA
GGCGCAGTTCTTGCGGCAGATGGTGGCCGCGGCGGATCACCACGCGGCCGCCGCTGGGAG
AGGAGGCGGCGACGGCGACGGCGGCGGCGGCGGCGGCGGTGGCGGGGAGAGGAAGCGGCG
GTTCACGGAGGAGCAGGTGCGGTCGCTGGAGACGACGTTCCACGCGCGGCGGGCCAAGCT
GGAGCCGCGGGAGAAGGCGGAGCTGGCGCGGGAGCTCGGGCTGCAGCCGCGCCAGGTGGC
CATCTGGTTCCAGAACAAGCGCGCCCGGTGGCGCTCCAAGCAGATCGAGCACGACTACGC
CGCGCTCCGCGCCCAGTACGACGCCCTCCACGCCCGCGTCGAGTCGCTCAGGCAGGAGAA
GCTCGCCCTCGCAGACCAGGTGGATGAGCTGAGGGGGAAGCTGAACGAGCGGCAAGACCA
GAgcggcagctgcgacggcggcggcgccgaaggggacgacgacgacaagaggaatagcgt
gatgaacgcgagcagcagcggcctcgtggaggaggactacgtgagctgcctcgcggtgcc
ggtggtggACGTCTCGGAGGACGGCTCGGCGGCGTGCGGCGGGTCGTCGTACGAGTACGA
CCATCACCTAGACTACTTGGGCGGCGGCCAGCTGCCCGATCCGTTCTGCGGCATGCCGGA
TCTGTGGGAGATATGGCCAATGGTGGAATGGAACGCAGTAGCATGATCATGCTAATCAAT
CAGCGTAGCATACAGTATATAAATATATATGTGTATGAGTACGTGTTGTATTGGGTCTAT
ATAGATATTTTGCTGCTGTTGCTGCTGCTGGCTTGTGCAGTCAGTTGGTCCGGAGAGATC
GACTAGAGCCGCGGCGCTCGTAAGCTAGACGGGAGAGCAGATTAGAGATGGAGGATGCAA
CCGGCCGGCCGGCAAACCATGCAACAATGCAAATCCACACATGCATTGCGTTGCACAGAT
AGAAATCCTCCGGCCGGTCGATCGCCGAGTCTTGCTGCTTGTTATGCTAGGATGCTACAT
TAATTATTCATGTTCGTGAATCTGGCTCCCCTGCCTCGGAGCCCGTTCGTGCACATATGT
GAAACATATATATCAACGCTGCGCATGTGTGCCATGCCCATGCGCATGCCGGCGCTTGTC
GTCCATGCTTTG

CDS

786 bp

>Os02t0649300-01 HD-ZIP I protein, Transcription activator, Stress response, Panicle development
ATGGAGAGCGACTGCCAGTTCTTGGTGGCGCCGCCGCAGCCGCACATGTACTACGACACG
GCGGCGGCGGCGGTGGACGAGGCGCAGTTCTTGCGGCAGATGGTGGCCGCGGCGGATCAC
CACGCGGCCGCCGCTGGGAGAGGAGGCGGCGACGGCGACGGCGGCGGCGGCGGCGGCGGT
GGCGGGGAGAGGAAGCGGCGGTTCACGGAGGAGCAGGTGCGGTCGCTGGAGACGACGTTC
CACGCGCGGCGGGCCAAGCTGGAGCCGCGGGAGAAGGCGGAGCTGGCGCGGGAGCTCGGG
CTGCAGCCGCGCCAGGTGGCCATCTGGTTCCAGAACAAGCGCGCCCGGTGGCGCTCCAAG
CAGATCGAGCACGACTACGCCGCGCTCCGCGCCCAGTACGACGCCCTCCACGCCCGCGTC
GAGTCGCTCAGGCAGGAGAAGCTCGCCCTCGCAGACCAGGTGGATGAGCTGAGGGGGAAG
CTGAACGAGCGGCAAGACCAGAgcggcagctgcgacggcggcggcgccgaaggggacgac
gacgacaagaggaatagcgtgatgaacgcgagcagcagcggcctcgtggaggaggactac
gtgagctgcctcgcggtgccggtggtggACGTCTCGGAGGACGGCTCGGCGGCGTGCGGC
GGGTCGTCGTACGAGTACGACCATCACCTAGACTACTTGGGCGGCGGCCAGCTGCCCGAT
CCGTTCTGCGGCATGCCGGATCTGTGGGAGATATGGCCAATGGTGGAATGGAACGCAGTA
GCATGA

Protein

261 aa

>Os02t0649300-01 HD-ZIP I protein, Transcription activator, Stress response, Panicle development
MESDCQFLVAPPQPHMYYDTAAAAVDEAQFLRQMVAAADHHAAAAGRGGGDGDGGGGGGG
GGERKRRFTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSK
QIEHDYAALRAQYDALHARVESLRQEKLALADQVDELRGKLNERQDQSGSCDGGGAEGDD
DDKRNSVMNASSSGLVEEDYVSCLAVPVVDVSEDGSAACGGSSYEYDHHLDYLGGGQLPD
PFCGMPDLWEIWPMVEWNAVA*

5'UTR

chr02:26143311..26143410 (+ strand) : 100 bp

CDS

chr02:26143411..26143869 (+ strand) : 459 bp

chr02:26143957..26144283 (+ strand) : 327 bp

3'UTR

chr02:26144284..26144729 (+ strand) : 446 bp

FASTA

>Os02t0649300-01 class=Sequence position=chr02:26143311..26144729 (+ strand)
GAACACACAC ACTACTGCGA CTGCTAGTGC TCTGGTCTTA CATTCGACGA ACTGATCGAT ATTCGATACG ACGTCTCCTC
CTACCTGGAG CTTGGGAAAA ATGGAGAGCG ACTGCCAGTT CTTGGTGGCG CCGCCGCAGC CGCACATGTA CTACGACACG
GCGGCGGCGG CGGTGGACGA GGCGCAGTTC TTGCGGCAGA TGGTGGCCGC GGCGGATCAC CACGCGGCCG CCGCTGGGAG
AGGAGGCGGC GACGGCGACG GCGGCGGCGG CGGCGGCGGT GGCGGGGAGA GGAAGCGGCG GTTCACGGAG GAGCAGGTGC
GGTCGCTGGA GACGACGTTC CACGCGCGGC GGGCCAAGCT GGAGCCGCGG GAGAAGGCGG AGCTGGCGCG GGAGCTCGGG
CTGCAGCCGC GCCAGGTGGC CATCTGGTTC CAGAACAAGC GCGCCCGGTG GCGCTCCAAG CAGATCGAGC ACGACTACGC
CGCGCTCCGC GCCCAGTACG ACGCCCTCCA CGCCCGCGTC GAGTCGCTCA GGCAGGAGAA GCTCGCCCTC GCAGACCAGG
TTCGTGCGCC ATTGCCGACC AATCATCAGC TATACCTGCT GCATACGTGC ACGCATGGTG ACAATGCGCG CTTTGCCTTC
TTGCAGGTGG ATGAGCTGAG GGGGAAGCTG AACGAGCGGC AAGACCAGAg cggcagctgc gacggcggcg gcgccgaagg
ggacgacgac gacaagagga atagcgtgat gaacgcgagc agcagcggcc tcgtggagga ggactacgtg agctgcctcg
cggtgccggt ggtggACGTC TCGGAGGACG GCTCGGCGGC GTGCGGCGGG TCGTCGTACG AGTACGACCA TCACCTAGAC
TACTTGGGCG GCGGCCAGCT GCCCGATCCG TTCTGCGGCA TGCCGGATCT GTGGGAGATA TGGCCAATGG TGGAATGGAA
CGCAGTAGCA TGATCATGCT AATCAATCAG CGTAGCATAC AGTATATAAA TATATATGTG TATGAGTACG TGTTGTATTG
GGTCTATATA GATATTTTGC TGCTGTTGCT GCTGCTGGCT TGTGCAGTCA GTTGGTCCGG AGAGATCGAC TAGAGCCGCG
GCGCTCGTAA GCTAGACGGG AGAGCAGATT AGAGATGGAG GATGCAACCG GCCGGCCGGC AAACCATGCA ACAATGCAAA
TCCACACATG CATTGCGTTG CACAGATAGA AATCCTCCGG CCGGTCGATC GCCGAGTCTT GCTGCTTGTT ATGCTAGGAT
GCTACATTAA TTATTCATGT TCGTGAATCT GGCTCCCCTG CCTCGGAGCC CGTTCGTGCA CATATGTGAA ACATATATAT
CAACGCTGCG CATGTGTGCC ATGCCCATGC GCATGCCGGC GCTTGTCGTC CATGCTTTG

Locus: Os02g0649300

Loading...

Locus: Os02g0649300

Loading...