Os02t0656500-01

Locus

Os02g0656500

Description

DnaJ-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA1

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A1

Transcript Evidence

AK066420 (DDBJ, Best hit)

Protein Evidence

Q949C1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ (IPR012724)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J013067J21 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0656500-01)

RiceXPro (AK066420)

Others

Oryzabase (12138)

KEGG (Os02t0656500-01)

Transcript

1824 bp

>Os02t0656500-01 DnaJ-like protein.
CTCTCTCTCTCCCTCGCCGCGCCGCCGCCGAACACACCCCCCCCACCCCCCCTCCCCACA
CGCCTCCGCCTCCTCGCACCGAACCGCCTCGGCGCGAGCGCGAGGGAGAGAGCTCCTCTT
CTCCTCCACGGCGGCTGCGCGGCGTCGTCCCGCTCCACCGGGCCGTCGTCTGGATCTGAT
CTAGGAGCGGTCGCTTCTTCCTCTTCCGGAAGCCCTTTTTATCAGTCATGTACGGACGCA
TGCCAAAGAAGAGTAACAATACCAAGTATTATGAGGTGCTTGGTGTATCTAAGACAGCAA
CCCAGGATGAGCTGAAGAAAGCGTACCGTAAAGCTGCCATTAAAAACCACCCTGATAAGG
GTGGAGACCCTGAGAAGTTTAAAGAATTGGCTCAAGCTTACGAGGTTCTTAATGATCCTG
AAAAGAGGGAAATCTATGACCAATATGGCGAGGATGCACTCAAAGAAGGAATGGGAGGAG
GCAGCAGCAGTGATTTCCATAGTCCCTTCGATTTATTTGAGCAAATTTTTCAGAATCGTG
GTGGCTTTGGGGGTAGAGGACACAGACAAAAGCGTGGCGAAGATGTGGTACATACTATGA
AGGTTTCTTTAGAAGACCTGTATAATGGTACTACCAAAAAACTGTCTTTGTCACGGAATG
CTCTGTGCACAAAGTGCAAGGGTAAAGGATCCAAGAGTGGGGCAGCAGCAACTTGCCATG
GTTGTCATGGTGCAGGAATGAGAACAATAACAAGACAAATTGGGCTTGGCATGATCCAAC
AGATGAACACTGTTTGCCCTGAATGCAGAGGATCAGGTGAGATGATAAGTGACAAGGATA
AATGCCCGAGTTGTAAGGGAAACAAAGTAGTCCAGCAGAAGAAGGTCTTGGAGGTTCATG
TTGAGAAGGGAATGCAACATGGCCAAAAGATTGTATTCCAGGGTGAAGCTGATGAAGCTC
CTGATACAGTGACAGGAGACATAGTTTTTGTCTTGCAACTTAAAGACCACCCAAAATTTA
AGAGGAAGTTTGATGACCTCTTTACTGAGCACACAATCTCCCTGACCGAGGCTCTGTGTG
GCTTCCAGTTTGTTCTAACCCATCTTGATGGTCGGCAACTCCTAATCAAATCTAATCCAG
GGGAGGTTATAAAACCTGGTCAACACAAGGCCATCAATGATGAAGGCATGCCCCAGCATG
GCCGCCCTTTCATGAAAGGTCGTCTTTTTGTTGAATTCAACGTGGAGTTTCCTGAGCCTG
GTGCACTCACTCCTGGCCAATGCCGATCGCTTGAGAAGATTTTGCCACCACGACCCAGGA
ATCAATTGTCAGACATGGAGCTAGATCAATGTGAGGAGACCACCATGCATGATGTCAACA
TAGAAGAGGAGATGAGGCGCAGGCAGCAGCACAGGCGGCAGGAAGCATATGATGAAGACG
ACGACGAGGATGCTGGAGCTGGACCAAGGGTACAGTGTGCCCAGCAGTAAGAACAATTCG
ATGCCATTCGGACTAGACGATTTAGCGTCTCTTATCATCCAAAGACCGCGGTAGCTACTG
AGTTCATTCTATTCTTTTTTTTAATGTACCCCCACCTAAAGTAGCTGATGCATGTTATGA
TTTCTCTTTTGTGGGAAATGTTATGCTACCATTTTTGTTGTCTTAAGATTAAGGAGCTTG
CTATTAGTCATAATGATGTTGCGGCCTCACTACAATTATTACAGCCTGCCGTATTATATA
CCAAAATGAGCTAATCCTCGACAATAATTCTTACAGACAGCGGACCGAATCAGTTGTATT
ATACTATTATGCCTGTGGTTCTGT

CDS

1263 bp

>Os02t0656500-01 DnaJ-like protein.
ATGTACGGACGCATGCCAAAGAAGAGTAACAATACCAAGTATTATGAGGTGCTTGGTGTA
TCTAAGACAGCAACCCAGGATGAGCTGAAGAAAGCGTACCGTAAAGCTGCCATTAAAAAC
CACCCTGATAAGGGTGGAGACCCTGAGAAGTTTAAAGAATTGGCTCAAGCTTACGAGGTT
CTTAATGATCCTGAAAAGAGGGAAATCTATGACCAATATGGCGAGGATGCACTCAAAGAA
GGAATGGGAGGAGGCAGCAGCAGTGATTTCCATAGTCCCTTCGATTTATTTGAGCAAATT
TTTCAGAATCGTGGTGGCTTTGGGGGTAGAGGACACAGACAAAAGCGTGGCGAAGATGTG
GTACATACTATGAAGGTTTCTTTAGAAGACCTGTATAATGGTACTACCAAAAAACTGTCT
TTGTCACGGAATGCTCTGTGCACAAAGTGCAAGGGTAAAGGATCCAAGAGTGGGGCAGCA
GCAACTTGCCATGGTTGTCATGGTGCAGGAATGAGAACAATAACAAGACAAATTGGGCTT
GGCATGATCCAACAGATGAACACTGTTTGCCCTGAATGCAGAGGATCAGGTGAGATGATA
AGTGACAAGGATAAATGCCCGAGTTGTAAGGGAAACAAAGTAGTCCAGCAGAAGAAGGTC
TTGGAGGTTCATGTTGAGAAGGGAATGCAACATGGCCAAAAGATTGTATTCCAGGGTGAA
GCTGATGAAGCTCCTGATACAGTGACAGGAGACATAGTTTTTGTCTTGCAACTTAAAGAC
CACCCAAAATTTAAGAGGAAGTTTGATGACCTCTTTACTGAGCACACAATCTCCCTGACC
GAGGCTCTGTGTGGCTTCCAGTTTGTTCTAACCCATCTTGATGGTCGGCAACTCCTAATC
AAATCTAATCCAGGGGAGGTTATAAAACCTGGTCAACACAAGGCCATCAATGATGAAGGC
ATGCCCCAGCATGGCCGCCCTTTCATGAAAGGTCGTCTTTTTGTTGAATTCAACGTGGAG
TTTCCTGAGCCTGGTGCACTCACTCCTGGCCAATGCCGATCGCTTGAGAAGATTTTGCCA
CCACGACCCAGGAATCAATTGTCAGACATGGAGCTAGATCAATGTGAGGAGACCACCATG
CATGATGTCAACATAGAAGAGGAGATGAGGCGCAGGCAGCAGCACAGGCGGCAGGAAGCA
TATGATGAAGACGACGACGAGGATGCTGGAGCTGGACCAAGGGTACAGTGTGCCCAGCAG
TAA

Protein

421 aa

>Os02t0656500-01 DnaJ-like protein.
MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFEQIFQNRGGFGGRGHRQKRGEDV
VHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKGSKSGAAATCHGCHGAGMRTITRQIGL
GMIQQMNTVCPECRGSGEMISDKDKCPSCKGNKVVQQKKVLEVHVEKGMQHGQKIVFQGE
ADEAPDTVTGDIVFVLQLKDHPKFKRKFDDLFTEHTISLTEALCGFQFVLTHLDGRQLLI
KSNPGEVIKPGQHKAINDEGMPQHGRPFMKGRLFVEFNVEFPEPGALTPGQCRSLEKILP
PRPRNQLSDMELDQCEETTMHDVNIEEEMRRRQQHRRQEAYDEDDDEDAGAGPRVQCAQQ
*

5'UTR

chr02:26519337..26519544 (+ strand) : 208 bp

chr02:26519988..26520006 (+ strand) : 19 bp

CDS

chr02:26520007..26520156 (+ strand) : 150 bp

chr02:26520243..26520417 (+ strand) : 175 bp

chr02:26520515..26520644 (+ strand) : 130 bp

chr02:26521932..26522065 (+ strand) : 134 bp

chr02:26522136..26522278 (+ strand) : 143 bp

chr02:26522401..26522599 (+ strand) : 199 bp

chr02:26522690..26523021 (+ strand) : 332 bp

3'UTR

chr02:26523022..26523355 (+ strand) : 334 bp

FASTA

>Os02t0656500-01 class=Sequence position=chr02:26519337..26523355 (+ strand)
CTCTCTCTCT CCCTCGCCGC GCCGCCGCCG AACACACCCC CCCCACCCCC CCTCCCCACA CGCCTCCGCC TCCTCGCACC
GAACCGCCTC GGCGCGAGCG CGAGGGAGAG AGCTCCTCTT CTCCTCCACG GCGGCTGCGC GGCGTCGTCC CGCTCCACCG
GGCCGTCGTC TGGATCTGAT CTAGGAGCGG TCGCTTCTTC CTCTTCCGGT GAGGAAGCCA GCCTTTGCCC TAGCTATGTA
GCTCGTGTTT TCGTTGGGTT TCCTGTGCTT TTTTTTTTTT AATTTGTGGC CGCAAACGGT GGGATCCATC CAGATCTGTG
ATGTTTGTTC GTGGAGAGTG GTCTCGGTTG ATCCCGTCTG ATACGGGTTG TTTTGATCTG TAGTTGTTTA TTACCCTGAG
TTAATACTAG CAATAACAAC TTGTTAATTT GGCGATTGGG ATGAACCCTA ATGGTTCTCG CTGAGTCCGC CCCTATGTAG
TATTGCAATA TGTATATCAT TCGAGCTCTA TTAGAAGATT GGTTCTTCTT ATTGCAAGAA TTGTGTGGTA TATTTTTTCT
TTGTTTGCAG GATATTAGTT TGTACTAATG CTACTCATTG TAGTTATTGC TTCATGATTT GTTGATCTGA TTCCAAGTTT
TACGTTTGTA GGAAGCCCTT TTTATCAGTC ATGTACGGAC GCATGCCAAA GAAGAGTAAC AATACCAAGT ATTATGAGGT
GCTTGGTGTA TCTAAGACAG CAACCCAGGA TGAGCTGAAG AAAGCGTACC GTAAAGCTGC CATTAAAAAC CACCCTGATA
AGGGTGGAGA CCCTGAGAAG GTCTGGGGAC AAACAGTTCT ATATTTGTCT ACTCTTGAAC TGTTGGTTTG GTTTGGTTGA
CGTTTTACTT TTTATGGCTT GGTCAGTTTA AAGAATTGGC TCAAGCTTAC GAGGTTCTTA ATGATCCTGA AAAGAGGGAA
ATCTATGACC AATATGGCGA GGATGCACTC AAAGAAGGAA TGGGAGGAGG CAGCAGCAGT GATTTCCATA GTCCCTTCGA
TTTATTTGAG CAAATTTTTC AGAATCGTGG TGGCTTTGGG GGTAATAAAA TTATGAAAAA TGCTTTACTT TGATCCTTTA
TCCTTCTATA TTTTAGAATG AAATATGCAC CTATTTACTG TTTTGTGGTT GAAAGTAGGT AGAGGACACA GACAAAAGCG
TGGCGAAGAT GTGGTACATA CTATGAAGGT TTCTTTAGAA GACCTGTATA ATGGTACTAC CAAAAAACTG TCTTTGTCAC
GGAATGCTCT GTGCACAAAG TGCAAGGGGT AAGTATCTTG CACATTCTCG AGTGGTTCTT TCATACTGAA AGGATTGTTA
TTTGTTATTG TCTTGAATTA TGAATATATA CAATTTATAA TAATAATAAC TATTGACTGC ACAATTTATA ATATTAATAA
CTATATTAAC TGCCCATGAT AACTTGGGGG GTTTACTTTC TTTATCTCTA AACTTAAGTT TGTCTTCAAA TTATTTTCTG
GATCATTTGA GTGTTAAAAA GTCCCTCTGA ATCTTATTTC TATATAACAT TTATTTCTGT TTTGTTTATT TTTATCACAT
AGTGAAGCAC TTTTGATTAA ATACGTGTAG CTGGTAATGA ACTACGAACT TAATTGGTTC ATTTGCACAA ATGCTATGTT
TAATCTATGG GAAGATGCAA TGTAGTTTAC GACTTGAAAA AGTCTGTGGC TGTATCTGCA ACAGGGCTAA CAGTAACTGC
GTAACTTGTC TATCTGTTTT TTGTGTTATA GGCATTTAAC ATGATTTTTT TTCCGAAAGT AAAAAAATGA AAAATATTAA
GAAGCAACAT AGTATATCAA ATTAATAGTG AATACATGGG CACCCAAGTT AAACAAGGAA GGAAGTGAGC CTAGCTCACT
TGGATTTGAG CTGAATATAT ACATATGTGG TAGATGTTAA GACTTGTTTT TGTCCAGCTA TGCTGCTGTC AGAAGCTGTT
CTGCCGGTTC TGACTTCTGA GTTTTGATGG ATGTGTTTTA AGAGAAATAT GCATGGATTT GGTCCTCGTA TAAGCGCACT
TCACACACAA GTAATATTTT GTAGTACAGC AGGCTCAAAC AAGTAATTAT TGTCATGTAA CACAACACTT GCTACCCACT
TCCCCTCTTA AATTCAAGGT GAAAAAACTA TTGTTGTTCT GAAAGTGGGG GTGAAACTCT AGTAACCTAG ATGACGATCT
GTGCAAATGT ACACTAAGGC CTTCTCTTTT CTGAACAACA AAACCAGTTT ATCTTTTTTT GTATTATTAC TACATCTGTT
TCTGTACTTG GCTACTTGCT GTATGTAAGA GTCATACTGC TACCTCTGCA TAGCATCTCC GAATTAGGTT ACAGGGTTGG
ATTTTGCCCC AACCATGCAG ATGTCCATTT ATTGCCCGAA CGTTCAGCTG AATTTGATGG TTCTCTACAA ATGAAACTTG
CAGTTTTGAC TCTTGTACTT GTAGTGCTCA ATTGTTACTC AGTTTAATGC ATTCTTTTTT TTTTCTAGTT TTGTTATATT
GGTCTCACTG TTGCCTTACG TTTTTGTACC TTCAGTAAAG GATCCAAGAG TGGGGCAGCA GCAACTTGCC ATGGTTGTCA
TGGTGCAGGA ATGAGAACAA TAACAAGACA AATTGGGCTT GGCATGATCC AACAGATGAA CACTGTTTGC CCTGAATGCA
GAGGATCAGG TATGCCATTG TTGTATCTTC ATTAGAAGAC ATCTTCTGGT TGAGTTTGCC TAATGATTAA TTTGTCCAGG
TGAGATGATA AGTGACAAGG ATAAATGCCC GAGTTGTAAG GGAAACAAAG TAGTCCAGCA GAAGAAGGTC TTGGAGGTTC
ATGTTGAGAA GGGAATGCAA CATGGCCAAA AGATTGTATT CCAGGGTGAA GCTGATGAAG CTGTGAGTCT TATTTACATA
AGTATCAGGC CGTCATGTGC GAAATGTGGC AACTCGCATC TTGATGTGTG TGTTCATAAT ATGTTGGAGC TCCCATCTAA
CATTGCAAAT TCATGCTTTT GCAGCCTGAT ACAGTGACAG GAGACATAGT TTTTGTCTTG CAACTTAAAG ACCACCCAAA
ATTTAAGAGG AAGTTTGATG ACCTCTTTAC TGAGCACACA ATCTCCCTGA CCGAGGCTCT GTGTGGCTTC CAGTTTGTTC
TAACCCATCT TGATGGTCGG CAACTCCTAA TCAAATCTAA TCCAGGGGAG GTTATAAAAC CTGGTATGCT TTCCTCTTTT
GACTCTTTTA CCCATTGCTG TCTGCCTTTA TAGTTTCTTG TTGGACATGT TGATAGATGA TTTTCTTGGA TAGGTCAACA
CAAGGCCATC AATGATGAAG GCATGCCCCA GCATGGCCGC CCTTTCATGA AAGGTCGTCT TTTTGTTGAA TTCAACGTGG
AGTTTCCTGA GCCTGGTGCA CTCACTCCTG GCCAATGCCG ATCGCTTGAG AAGATTTTGC CACCACGACC CAGGAATCAA
TTGTCAGACA TGGAGCTAGA TCAATGTGAG GAGACCACCA TGCATGATGT CAACATAGAA GAGGAGATGA GGCGCAGGCA
GCAGCACAGG CGGCAGGAAG CATATGATGA AGACGACGAC GAGGATGCTG GAGCTGGACC AAGGGTACAG TGTGCCCAGC
AGTAAGAACA ATTCGATGCC ATTCGGACTA GACGATTTAG CGTCTCTTAT CATCCAAAGA CCGCGGTAGC TACTGAGTTC
ATTCTATTCT TTTTTTTAAT GTACCCCCAC CTAAAGTAGC TGATGCATGT TATGATTTCT CTTTTGTGGG AAATGTTATG
CTACCATTTT TGTTGTCTTA AGATTAAGGA GCTTGCTATT AGTCATAATG ATGTTGCGGC CTCACTACAA TTATTACAGC
CTGCCGTATT ATATACCAAA ATGAGCTAAT CCTCGACAAT AATTCTTACA GACAGCGGAC CGAATCAGTT GTATTATACT
ATTATGCCTG TGGTTCTGT

Locus: Os02g0656500

Loading...

Locus: Os02g0656500

Loading...