Os02t0656500-02

Locus

Os02g0656500

Description

Similar to DnaJ-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA1

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A1

Transcript Evidence

AK062239 (DDBJ, Best hit)

Protein Evidence

Q949C1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Chaperone DnaJ, C-terminal (IPR002939)

HSP40/DnaJ peptide-binding (IPR008971)

Full-length cDNA

001-047-E06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0656500-02)

RiceXPro (AK062239)

Others

Oryzabase (12138)

KEGG (Os02t0656500-02)

Transcript

1356 bp

>Os02t0656500-02 Similar to DnaJ-like protein.
TGAAAAGAGGGAAATCTATGACCAATATGGCGAGGATGCACTCAAAGAAGGAATGGGAGG
AGGCAGCAGCAGTGATTTCCATAGTCCCTTCGATTTATTTGAGCAAATTTTTCAGAATCG
TGGTGGCTTTGGGGGTAGAGGACACAGACAAAAGCGTGGCGAAGATGTGGTACATACTAT
GAAGGTTTCTTTAGAAGACCTGTATAATGGTACTACCAAAAAACTGTCTTTGTCACGGAA
TGCTCTGTGCACAAAGTGCAAGGGTAAAGGATCCAAGAGTGGGGCAGCAGCAACTTGCCA
TGGTTGTCATGGTGCAGGAATGAGAACAATAACAAGACAAATTGGGCTTGGCATGATCCA
ACAGATGAACACTGTTTGCCCTGAATGCAGAGGATCAGGTGAGATGATAAGTGACAAGGA
TAAATGCCCGAGTTGTAAGGGAAACAAAGTAGTCCAGCAGAAGAAGGTCTTGGAGGTTCA
TGTTGAGAAGGGAATGCAACATGGCCAAAAGATTGTATTCCAGGGTGAAGCTGATGAAGC
TCCTGATACAGTGACAGGAGACATAGTTTTTGTCTTGCAACTTAAAGACCACCCAAAATT
TAAGAGGAAGTTTGATGACCTCTTTACTGAGCACACAATCTCCCTGACCGAGGCTCTGTG
TGGCTTCCAGTTTGTTCTAACCCATCTTGATGGTCGGCAACTCCTAATCAAATCTAATCC
AGGGGAGGTTATAAAACCTGGTCAACACAAGGCCATCAATGATGAAGGCATGCCCCAGCA
TGGCCGCCCTTTCATGAAAGGTCGTCTTTTTGTTGAATTCAACGTGGAGTTTCCTGAGCC
TGGTGCACTCACTCCTGGCCAATGCCGATCGCTTGAGAAGATTTTGCCACCACGACCCAG
GAATCAATTGTCAGACATGGAGCTAGATCAATGTGAGGAGACCACCATGCATGATGTCAA
CATAGAAGAGGAGATGAGGCGCAGGCAGCAGCACAGGCGGCAGGAAGCATATGATGAAGA
CGACGACGAGGATGCTGGAGCTGGACCAAGGGTACAGTGTGCCCAGCAGTAAGAACAATT
CGATGCCATTCGGACTAGACGATTTAGCGTCTCTTATCATCCAAAGACCGCGGTAGCTAC
TGAGTTCATTCTATTCTTTTTTTTAATGTACCCCCACCTAAAGTAGCTGATGCATGTTAT
GATTTCTCTTTTGTGGGAAATGTTATGCTACCATTTTTGTTGTCTTAAGATTAAGGAGCT
TGCTATTAGTCATAATGATGTTGCGGCCTCACTACAATTATTACAGCCTGCCGTATTATA
TACCAAAATGAGCTAATCCTCGACAATAATTCTTAC

CDS

1071 bp

>Os02t0656500-02 Similar to DnaJ-like protein.
GAAAAGAGGGAAATCTATGACCAATATGGCGAGGATGCACTCAAAGAAGGAATGGGAGGA
GGCAGCAGCAGTGATTTCCATAGTCCCTTCGATTTATTTGAGCAAATTTTTCAGAATCGT
GGTGGCTTTGGGGGTAGAGGACACAGACAAAAGCGTGGCGAAGATGTGGTACATACTATG
AAGGTTTCTTTAGAAGACCTGTATAATGGTACTACCAAAAAACTGTCTTTGTCACGGAAT
GCTCTGTGCACAAAGTGCAAGGGTAAAGGATCCAAGAGTGGGGCAGCAGCAACTTGCCAT
GGTTGTCATGGTGCAGGAATGAGAACAATAACAAGACAAATTGGGCTTGGCATGATCCAA
CAGATGAACACTGTTTGCCCTGAATGCAGAGGATCAGGTGAGATGATAAGTGACAAGGAT
AAATGCCCGAGTTGTAAGGGAAACAAAGTAGTCCAGCAGAAGAAGGTCTTGGAGGTTCAT
GTTGAGAAGGGAATGCAACATGGCCAAAAGATTGTATTCCAGGGTGAAGCTGATGAAGCT
CCTGATACAGTGACAGGAGACATAGTTTTTGTCTTGCAACTTAAAGACCACCCAAAATTT
AAGAGGAAGTTTGATGACCTCTTTACTGAGCACACAATCTCCCTGACCGAGGCTCTGTGT
GGCTTCCAGTTTGTTCTAACCCATCTTGATGGTCGGCAACTCCTAATCAAATCTAATCCA
GGGGAGGTTATAAAACCTGGTCAACACAAGGCCATCAATGATGAAGGCATGCCCCAGCAT
GGCCGCCCTTTCATGAAAGGTCGTCTTTTTGTTGAATTCAACGTGGAGTTTCCTGAGCCT
GGTGCACTCACTCCTGGCCAATGCCGATCGCTTGAGAAGATTTTGCCACCACGACCCAGG
AATCAATTGTCAGACATGGAGCTAGATCAATGTGAGGAGACCACCATGCATGATGTCAAC
ATAGAAGAGGAGATGAGGCGCAGGCAGCAGCACAGGCGGCAGGAAGCATATGATGAAGAC
GACGACGAGGATGCTGGAGCTGGACCAAGGGTACAGTGTGCCCAGCAGTAA

Protein

357 aa

>Os02t0656500-02 Similar to DnaJ-like protein.
EKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFEQIFQNRGGFGGRGHRQKRGEDVVHTM
KVSLEDLYNGTTKKLSLSRNALCTKCKGKGSKSGAAATCHGCHGAGMRTITRQIGLGMIQ
QMNTVCPECRGSGEMISDKDKCPSCKGNKVVQQKKVLEVHVEKGMQHGQKIVFQGEADEA
PDTVTGDIVFVLQLKDHPKFKRKFDDLFTEHTISLTEALCGFQFVLTHLDGRQLLIKSNP
GEVIKPGQHKAINDEGMPQHGRPFMKGRLFVEFNVEFPEPGALTPGQCRSLEKILPPRPR
NQLSDMELDQCEETTMHDVNIEEEMRRRQQHRRQEAYDEDDDEDAGAGPRVQCAQQ*

5'UTR

chr02:26520284..26520284 (+ strand) : 1 bp

CDS

chr02:26520285..26520417 (+ strand) : 133 bp

chr02:26520515..26520644 (+ strand) : 130 bp

chr02:26521932..26522065 (+ strand) : 134 bp

chr02:26522136..26522278 (+ strand) : 143 bp

chr02:26522401..26522599 (+ strand) : 199 bp

chr02:26522690..26523021 (+ strand) : 332 bp

3'UTR

chr02:26523022..26523305 (+ strand) : 284 bp

FASTA

>Os02t0656500-02 class=Sequence position=chr02:26520284..26523305 (+ strand)
TGAAAAGAGG GAAATCTATG ACCAATATGG CGAGGATGCA CTCAAAGAAG GAATGGGAGG AGGCAGCAGC AGTGATTTCC
ATAGTCCCTT CGATTTATTT GAGCAAATTT TTCAGAATCG TGGTGGCTTT GGGGGTAATA AAATTATGAA AAATGCTTTA
CTTTGATCCT TTATCCTTCT ATATTTTAGA ATGAAATATG CACCTATTTA CTGTTTTGTG GTTGAAAGTA GGTAGAGGAC
ACAGACAAAA GCGTGGCGAA GATGTGGTAC ATACTATGAA GGTTTCTTTA GAAGACCTGT ATAATGGTAC TACCAAAAAA
CTGTCTTTGT CACGGAATGC TCTGTGCACA AAGTGCAAGG GGTAAGTATC TTGCACATTC TCGAGTGGTT CTTTCATACT
GAAAGGATTG TTATTTGTTA TTGTCTTGAA TTATGAATAT ATACAATTTA TAATAATAAT AACTATTGAC TGCACAATTT
ATAATATTAA TAACTATATT AACTGCCCAT GATAACTTGG GGGGTTTACT TTCTTTATCT CTAAACTTAA GTTTGTCTTC
AAATTATTTT CTGGATCATT TGAGTGTTAA AAAGTCCCTC TGAATCTTAT TTCTATATAA CATTTATTTC TGTTTTGTTT
ATTTTTATCA CATAGTGAAG CACTTTTGAT TAAATACGTG TAGCTGGTAA TGAACTACGA ACTTAATTGG TTCATTTGCA
CAAATGCTAT GTTTAATCTA TGGGAAGATG CAATGTAGTT TACGACTTGA AAAAGTCTGT GGCTGTATCT GCAACAGGGC
TAACAGTAAC TGCGTAACTT GTCTATCTGT TTTTTGTGTT ATAGGCATTT AACATGATTT TTTTTCCGAA AGTAAAAAAA
TGAAAAATAT TAAGAAGCAA CATAGTATAT CAAATTAATA GTGAATACAT GGGCACCCAA GTTAAACAAG GAAGGAAGTG
AGCCTAGCTC ACTTGGATTT GAGCTGAATA TATACATATG TGGTAGATGT TAAGACTTGT TTTTGTCCAG CTATGCTGCT
GTCAGAAGCT GTTCTGCCGG TTCTGACTTC TGAGTTTTGA TGGATGTGTT TTAAGAGAAA TATGCATGGA TTTGGTCCTC
GTATAAGCGC ACTTCACACA CAAGTAATAT TTTGTAGTAC AGCAGGCTCA AACAAGTAAT TATTGTCATG TAACACAACA
CTTGCTACCC ACTTCCCCTC TTAAATTCAA GGTGAAAAAA CTATTGTTGT TCTGAAAGTG GGGGTGAAAC TCTAGTAACC
TAGATGACGA TCTGTGCAAA TGTACACTAA GGCCTTCTCT TTTCTGAACA ACAAAACCAG TTTATCTTTT TTTGTATTAT
TACTACATCT GTTTCTGTAC TTGGCTACTT GCTGTATGTA AGAGTCATAC TGCTACCTCT GCATAGCATC TCCGAATTAG
GTTACAGGGT TGGATTTTGC CCCAACCATG CAGATGTCCA TTTATTGCCC GAACGTTCAG CTGAATTTGA TGGTTCTCTA
CAAATGAAAC TTGCAGTTTT GACTCTTGTA CTTGTAGTGC TCAATTGTTA CTCAGTTTAA TGCATTCTTT TTTTTTTCTA
GTTTTGTTAT ATTGGTCTCA CTGTTGCCTT ACGTTTTTGT ACCTTCAGTA AAGGATCCAA GAGTGGGGCA GCAGCAACTT
GCCATGGTTG TCATGGTGCA GGAATGAGAA CAATAACAAG ACAAATTGGG CTTGGCATGA TCCAACAGAT GAACACTGTT
TGCCCTGAAT GCAGAGGATC AGGTATGCCA TTGTTGTATC TTCATTAGAA GACATCTTCT GGTTGAGTTT GCCTAATGAT
TAATTTGTCC AGGTGAGATG ATAAGTGACA AGGATAAATG CCCGAGTTGT AAGGGAAACA AAGTAGTCCA GCAGAAGAAG
GTCTTGGAGG TTCATGTTGA GAAGGGAATG CAACATGGCC AAAAGATTGT ATTCCAGGGT GAAGCTGATG AAGCTGTGAG
TCTTATTTAC ATAAGTATCA GGCCGTCATG TGCGAAATGT GGCAACTCGC ATCTTGATGT GTGTGTTCAT AATATGTTGG
AGCTCCCATC TAACATTGCA AATTCATGCT TTTGCAGCCT GATACAGTGA CAGGAGACAT AGTTTTTGTC TTGCAACTTA
AAGACCACCC AAAATTTAAG AGGAAGTTTG ATGACCTCTT TACTGAGCAC ACAATCTCCC TGACCGAGGC TCTGTGTGGC
TTCCAGTTTG TTCTAACCCA TCTTGATGGT CGGCAACTCC TAATCAAATC TAATCCAGGG GAGGTTATAA AACCTGGTAT
GCTTTCCTCT TTTGACTCTT TTACCCATTG CTGTCTGCCT TTATAGTTTC TTGTTGGACA TGTTGATAGA TGATTTTCTT
GGATAGGTCA ACACAAGGCC ATCAATGATG AAGGCATGCC CCAGCATGGC CGCCCTTTCA TGAAAGGTCG TCTTTTTGTT
GAATTCAACG TGGAGTTTCC TGAGCCTGGT GCACTCACTC CTGGCCAATG CCGATCGCTT GAGAAGATTT TGCCACCACG
ACCCAGGAAT CAATTGTCAG ACATGGAGCT AGATCAATGT GAGGAGACCA CCATGCATGA TGTCAACATA GAAGAGGAGA
TGAGGCGCAG GCAGCAGCAC AGGCGGCAGG AAGCATATGA TGAAGACGAC GACGAGGATG CTGGAGCTGG ACCAAGGGTA
CAGTGTGCCC AGCAGTAAGA ACAATTCGAT GCCATTCGGA CTAGACGATT TAGCGTCTCT TATCATCCAA AGACCGCGGT
AGCTACTGAG TTCATTCTAT TCTTTTTTTT AATGTACCCC CACCTAAAGT AGCTGATGCA TGTTATGATT TCTCTTTTGT
GGGAAATGTT ATGCTACCAT TTTTGTTGTC TTAAGATTAA GGAGCTTGCT ATTAGTCATA ATGATGTTGC GGCCTCACTA
CAATTATTAC AGCCTGCCGT ATTATATACC AAAATGAGCT AATCCTCGAC AATAATTCTT AC

Locus: Os02g0656500

Loading...

Locus: Os02g0656500

Loading...