Os02t0661100-01

Locus

Os02g0661100

Description

Similar to Trehalose-6-phosphate phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TPP1

CGSNL Gene Name

TREHALOSE-6-PHOSPHATE PHOSHPHATASE 1

Oryzabase Gene Symbol Synonym(s)

OsTPP1, OsTPS

Oryzabase Gene Name Synonym(s)

Trehalose-6-phosphate phosphatase 1, trehalose 6-P synthase

Transcript Evidence

AK103391 (DDBJ, Best hit)

Protein Evidence

D4QAK5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: trehalose biosynthetic process (GO:0005992)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Trehalose-phosphatase (IPR003337)

HAD-superfamily hydrolase, subfamily IIB (IPR006379)

HAD-like domain (IPR023214)

Full-length cDNA

J033127L03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0661100-01)

RiceXPro (AK103391)

Others

Oryzabase (6270)

KEGG (Os02t0661100-01)

Transcript

1768 bp

>Os02t0661100-01 Similar to Trehalose-6-phosphate phosphatase.
AGCACTCCATCTTCCTCCATCTGCGTATTTTCCAACACATCTCTCTTGCAGTTCGTTTCA
AGTCTTTCATTAAGTAAAACTTTCTGAACATTTGAAGTGCAACGGAGCTGGCGTTTTATG
GCTTTTCCTATGAAGCAATCCACATCTCTGATATAGATGTGTACTCGTTCTGAACATGAC
AAGTTCTCAGGTATTTCTCTGTTGATGAACTGCCTCCACACCTGCAGTGACAAGAAGACA
CTGAAGAAGTGGTTTTTCATCGACAAGACAGTTGGCTAAATTCAGCAGTGCACTCGTCCT
TAAAGCGATCGATCATACTTCTTTCTTGATCTCATCATCCTAAATTTTCCCAAATGGATT
TGAGCAATAGCTCACCTGTCATCACCGATCCGGTGGCGATCAGCCAGCAGTTGTTGGGCG
GCCTGCCTTCAAATCTGATGCAGTTTTCAGTCATGCCCGGTGGCTACTCCAGCTCTGGCA
TGAACGTTGGTGTCAGTAGGCTCAAAATCGAGGAAGTCCTTGTCAATGGACTGCTTGATG
CCATGAAATCCTCGTCACCTCGCAGGAGGCTGAATGTAGCATTTGGCGAGGACAATTCAT
CTGAAGAAGAAGACCCTGCTTACAGCGCTTGGATGGCAAAATGTCCTTCTGCTTTGGCTT
CCTTCAAGCAAATTGTAGCCAGTGCACAAGGGAAGAAGATTGCTGTGTTTCTAGACTATG
ACGGCACACTGTCGCCTATTGTGGATGATCCTGACAAAGCAGTGATGTCTCCCGTGATGA
GAGCTGCTGTGAGAAATGTTGCGAAGTACTTCCCCACTGCAATTGTCAGCGGAAGGTCCC
GCAATAAGGTGTTTGAATTTGTAAAACTGAAGGAGCTTTATTATGCTGGAAGCCATGGTA
TGGACATAATGGCACCTTCAGCAAATCATGAGCACAGTGCTGAAAAGAGCAAACAGGCCA
ATCTCTTCCAACCTGCACACGACTTTCTGCCAATGATCGATGAGGTTACCAAGTCCCTCT
TGCAAGTTGTCAGTGGAATTGAAGGTGCAACTGTTGAGAACAACAAATTCTGCGTTTCTG
TACATTATCGCAACGTTGCAGAGAAGGATTGGAAACTGGTCGCACGGCTCGTAAACGAAG
TGCTGGAGGCTTTTCCTCGTCTCAAAGTAACCAATGGACGAATGGTTTTAGAGGTTCGTC
CGGTGATCGACTGGGACAAGGGAAAGGCTGTGGAGTTTCTGCTCCAGTCACTCGGGCTAA
ATGACTCTGAAAATGTGATCCCCATCTACATTGGAGACGACAGAACTGACGAAGACGCTT
TCAAGGTACTTCGACAGCGAAATTGCGGTTATGGAATACTAGTTTCACAGGTTCCCAAGG
AAACTGAAGCCTTCTACTCGCTGAGAGATCCATCTGAAGTGATGGAGTTCCTCAATTTCT
TGGTGAGATGGAAGAAGCACTCAGTGTGAAAAAAAGAAGACAGTCTGAGCAGGTTTTACT
AATACTACTCCGGCAGAAATAACTGTAGTTTCCGAGGCGACAATTTTGAAGCATTGGACG
CTGTAGATAGATGTAATAACTCTCTAGATATGTGGTTCCAATTCATTCTTATTGATCGAT
GTTATTGTATTGTTCATGTTCTCCACCGCTGAGAAAAATTAATCAGTGATGGTTGATCCG
GTCTCTTGCCATTGTAAGTTGTAAGCAAGAAGGCCCTCTTCTTAGTATCCATGCTGATGA
ACGAAATTAAAACCTTCATTTTTCGTGT

CDS

1116 bp

>Os02t0661100-01 Similar to Trehalose-6-phosphate phosphatase.
ATGGATTTGAGCAATAGCTCACCTGTCATCACCGATCCGGTGGCGATCAGCCAGCAGTTG
TTGGGCGGCCTGCCTTCAAATCTGATGCAGTTTTCAGTCATGCCCGGTGGCTACTCCAGC
TCTGGCATGAACGTTGGTGTCAGTAGGCTCAAAATCGAGGAAGTCCTTGTCAATGGACTG
CTTGATGCCATGAAATCCTCGTCACCTCGCAGGAGGCTGAATGTAGCATTTGGCGAGGAC
AATTCATCTGAAGAAGAAGACCCTGCTTACAGCGCTTGGATGGCAAAATGTCCTTCTGCT
TTGGCTTCCTTCAAGCAAATTGTAGCCAGTGCACAAGGGAAGAAGATTGCTGTGTTTCTA
GACTATGACGGCACACTGTCGCCTATTGTGGATGATCCTGACAAAGCAGTGATGTCTCCC
GTGATGAGAGCTGCTGTGAGAAATGTTGCGAAGTACTTCCCCACTGCAATTGTCAGCGGA
AGGTCCCGCAATAAGGTGTTTGAATTTGTAAAACTGAAGGAGCTTTATTATGCTGGAAGC
CATGGTATGGACATAATGGCACCTTCAGCAAATCATGAGCACAGTGCTGAAAAGAGCAAA
CAGGCCAATCTCTTCCAACCTGCACACGACTTTCTGCCAATGATCGATGAGGTTACCAAG
TCCCTCTTGCAAGTTGTCAGTGGAATTGAAGGTGCAACTGTTGAGAACAACAAATTCTGC
GTTTCTGTACATTATCGCAACGTTGCAGAGAAGGATTGGAAACTGGTCGCACGGCTCGTA
AACGAAGTGCTGGAGGCTTTTCCTCGTCTCAAAGTAACCAATGGACGAATGGTTTTAGAG
GTTCGTCCGGTGATCGACTGGGACAAGGGAAAGGCTGTGGAGTTTCTGCTCCAGTCACTC
GGGCTAAATGACTCTGAAAATGTGATCCCCATCTACATTGGAGACGACAGAACTGACGAA
GACGCTTTCAAGGTACTTCGACAGCGAAATTGCGGTTATGGAATACTAGTTTCACAGGTT
CCCAAGGAAACTGAAGCCTTCTACTCGCTGAGAGATCCATCTGAAGTGATGGAGTTCCTC
AATTTCTTGGTGAGATGGAAGAAGCACTCAGTGTGA

Protein

372 aa

>Os02t0661100-01 Similar to Trehalose-6-phosphate phosphatase.
MDLSNSSPVITDPVAISQQLLGGLPSNLMQFSVMPGGYSSSGMNVGVSRLKIEEVLVNGL
LDAMKSSSPRRRLNVAFGEDNSSEEEDPAYSAWMAKCPSALASFKQIVASAQGKKIAVFL
DYDGTLSPIVDDPDKAVMSPVMRAAVRNVAKYFPTAIVSGRSRNKVFEFVKLKELYYAGS
HGMDIMAPSANHEHSAEKSKQANLFQPAHDFLPMIDEVTKSLLQVVSGIEGATVENNKFC
VSVHYRNVAEKDWKLVARLVNEVLEAFPRLKVTNGRMVLEVRPVIDWDKGKAVEFLLQSL
GLNDSENVIPIYIGDDRTDEDAFKVLRQRNCGYGILVSQVPKETEAFYSLRDPSEVMEFL
NFLVRWKKHSV*

5'UTR

chr02:26771550..26771623 (- strand) : 74 bp

chr02:26770273..26770381 (- strand) : 109 bp

chr02:26770011..26770180 (- strand) : 170 bp

CDS

chr02:26769729..26770010 (- strand) : 282 bp

chr02:26769471..26769611 (- strand) : 141 bp

chr02:26769311..26769382 (- strand) : 72 bp

chr02:26769102..26769200 (- strand) : 99 bp

chr02:26768927..26768983 (- strand) : 57 bp

chr02:26768653..26768754 (- strand) : 102 bp

chr02:26768480..26768557 (- strand) : 78 bp

chr02:26768228..26768368 (- strand) : 141 bp

chr02:26768040..26768132 (- strand) : 93 bp

chr02:26767906..26767956 (- strand) : 51 bp

3'UTR

chr02:26767607..26767905 (- strand) : 299 bp

FASTA

>Os02t0661100-01 class=Sequence position=chr02:26767607..26771623 (- strand)
AGCACTCCAT CTTCCTCCAT CTGCGTATTT TCCAACACAT CTCTCTTGCA GTTCGTTTCA AGTCTTTCAT TAAGGTGTGC
GTCTTCTTCT CTTTGTCATT CTTCTAGATC ACCTGCTTAT ACTTCTGCAT TTCTGCATGC AATGCTCAGT TGGTCCAACA
TTTGTTCTTT GAACTTACTG CATGCTCTTT TGATGTCTTT GTTTCTGCAA AAATATAGGC ACCGAAGTGC CAAAACTGAA
CTTCGGTGCC TTTCTCACTG AGAAAACGGA TACTTTTCTG TTGTAAAGGA TGCTGTGATT GTTGGAGTTC ATGTAGGTCC
TCGAAAAGTG TGAAAACAGC CAAAAAATGC ACTCGTTCTG AGAATTGCTT GAGAACTGTA AACATGGCCA CAATTTGCTA
GAGCTAGCTA AAACTGCTAT CGGATCCACT TATTTCCTTA CCTTTTTCTT GATTTTTTCT TGTTTCATCT CCCTAGGGTT
GTTAATGTTC AGCATATCCA TTGACATTTT CTTTTAGACA CCCAGTTTTC TTATTTTCTG ACCGGGTCAA TTTCCACTCA
AAGTTCGTAT TTGAAAACAT GTTCGATGAC CAAAACAATT TTTTCAAGTC TATTCTTCTT CAAGTCAATT CTCCTAAAGA
TTTCCAACTT GATTTTTTTT TCACAATAAA AATCTCTAAC CTTACGTTAT ATGCTTCCAT CACACAGTTT AGTAGAATAT
ATAAGCTGAC GTTATTGTGC TTCCATCATG GCTAATAGCG ATGTACTAGT GGTTGCTCTT TTAAGGTTGG TGCCCATGGT
TAATTGCGTT CTGAACTTTG ACGCGTTAGG TTTACCTACC ATTTCTTTGA GTTCAGAAAC ACTCATTAAG ACATTAACCC
ATGGGCCCAA GCACACATGG CCTCAGTGAT TAGTCCAGCA TATCGTTGTA GTAGATATCA AGACATTGAG CCTAACTGTG
TTAATGATCA TCCTTTTCCT CCGGCAGATA TTTTATTCTT TTTTATTCGA CTCAGAGTGA CATTGTACTG CTAAACCACA
GTTGATGCCA CACTTAATCC TGGGCCCATT TTTTTTCTTT CCTTGGCATC TTGTAGTATT TTCCCTTTTG TTGATGTTGA
TTTGTTCCTT TGCTCATGAA TGACAAGGAC ACACATTTAT TACGGCCTGA CACTTGAGGA GGACATGGCT GTCGTTTTAC
TTCTGTGTAA ATGAAAAGAT TTTTCCTTCT TGATTTATGC AGTAAAACTT TCTGAACATT TGAAGTGCAA CGGAGCTGGC
GTTTTATGGC TTTTCCTATG AAGCAATCCA CATCTCTGAT ATAGATGTGT ACTCGTTCTG AACATGACAA GGTACGGCAC
ATCCTAAAAC TGTTACTACT ATTTTCATCT CATGGAAAAC AAGAGCAGTT TCTCTAATAC TTTGTCTTAC ATTGTCTGAT
CAGTTCTCAG GTATTTCTCT GTTGATGAAC TGCCTCCACA CCTGCAGTGA CAAGAAGACA CTGAAGAAGT GGTTTTTCAT
CGACAAGACA GTTGGCTAAA TTCAGCAGTG CACTCGTCCT TAAAGCGATC GATCATACTT CTTTCTTGAT CTCATCATCC
TAAATTTTCC CAAATGGATT TGAGCAATAG CTCACCTGTC ATCACCGATC CGGTGGCGAT CAGCCAGCAG TTGTTGGGCG
GCCTGCCTTC AAATCTGATG CAGTTTTCAG TCATGCCCGG TGGCTACTCC AGCTCTGGCA TGAACGTTGG TGTCAGTAGG
CTCAAAATCG AGGAAGTCCT TGTCAATGGA CTGCTTGATG CCATGAAATC CTCGTCACCT CGCAGGAGGC TGAATGTAGC
ATTTGGCGAG GACAATTCAT CTGAAGAAGA AGACCCTGCT TACAGCGCTT GGATGGTAAG CTACAATGGT TACATTGGTT
GTGTTTCTGT TGGCCTAATA AGTTGTACTA GTAACTCGCA ATCCTTTTCT TTTCGTGGAC AGTACTGACA TATGTGATGA
CTTGTGTTGC AGGCAAAATG TCCTTCTGCT TTGGCTTCCT TCAAGCAAAT TGTAGCCAGT GCACAAGGGA AGAAGATTGC
TGTGTTTCTA GACTATGACG GCACACTGTC GCCTATTGTG GATGATCCTG ACAAAGCAGT GATGTCTCCC GTGGTAAGTC
TGAATATAAA CTCTGACCAA TAACTAGCAT TTCTTGGTTA ATGAAGAGCT GCTTTGAATT AAATTAAAAA CTTTTCCTCA
GATGAGAGCT GCTGTGAGAA ATGTTGCGAA GTACTTCCCC ACTGCAATTG TCAGCGGAAG GTCCCGCAAT AAGGTACCGA
AAATATGGTT GCATGCATTT TAGTGTACTA GTATTAGAAG CCAAGTGATT GCATATGCAA GTGTATGTCT TATCTTACAT
ATGGCTTACT TATCTCTATG CAGGTGTTTG AATTTGTAAA ACTGAAGGAG CTTTATTATG CTGGAAGCCA TGGTATGGAC
ATAATGGCAC CTTCAGCAAA TCATGAGCAC AGTGCTGAAA AGGTGAGGAT TTCTTGCCTA TGTTTCTACA AATAGAGTGA
AAAAGTCTAC CTTTTTTGGG GGCATTCTAA CAAATATGTT CTAGTGTAAA ATACTGACTA TGGCTTAATT CCAACTACAG
AGCAAACAGG CCAATCTCTT CCAACCTGCA CACGACTTTC TGCCAATGAT CGATGAGGTG CATTTCTCTT TCAACTTTGA
AGTAAAAAAG TTGTATTGCT CTATCCAGTT TAACGCAAAT ATAAAACGAT TCCATCATCT CATTATTATT CATATAAATT
ACTGTGATTA GTCCTGATGG GTGTGCAAAA GTTTTGTGCT ATTTGTTAAC AAACTTTTTA TTTCAACAGG TTACCAAGTC
CCTCTTGCAA GTTGTCAGTG GAATTGAAGG TGCAACTGTT GAGAACAACA AATTCTGCGT TTCTGTACAT TATCGCAACG
TTGCAGAGAA GGTAAAAACT GTTTTTTTTT CCGTCATACT TTTTTCTCTG CTCCCAAGCG CTTGGAAAAT GAAAATTCAT
CTGACAATAT TGCTTCTTGT TTGCAGGATT GGAAACTGGT CGCACGGCTC GTAAACGAAG TGCTGGAGGC TTTTCCTCGT
CTCAAAGTAA CCAATGGACG AATGGTAAGA ACGCTATGCC AAGTCTATTT AGCTGTACAC TGAAACTTAC CCATTTCCTG
GTAATTTGCA CATCTATCAA ACCCTGTGCT GAATATTCTG GAAATATATC TTCAGGTTTT AGAGGTTCGT CCGGTGATCG
ACTGGGACAA GGGAAAGGCT GTGGAGTTTC TGCTCCAGTC ACTCGGGCTA AATGACTCTG AAAATGTGAT CCCCATCTAC
ATTGGAGACG ACAGAACTGA CGAAGACGCT TTCAAGGTTC ATATATTTTC TGGAGAACAC GTAGTGCTGT ATATCCTAGT
CGCATCTTTG ATTCAGTGTA AACTGATATA GCGGTCATTT GGTTTAACCA GGTACTTCGA CAGCGAAATT GCGGTTATGG
AATACTAGTT TCACAGGTTC CCAAGGAAAC TGAAGCCTTC TACTCGCTGA GAGATCCATC TGAAGTAAGC TCAAAAGAAT
ATCTTTCTTC TTCCTTGGGT GATTTTCATT CGACGTGTTC ATCATTAACT GTTTGCTTAT CGTACAGGTG ATGGAGTTCC
TCAATTTCTT GGTGAGATGG AAGAAGCACT CAGTGTGAAA AAAAGAAGAC AGTCTGAGCA GGTTTTACTA ATACTACTCC
GGCAGAAATA ACTGTAGTTT CCGAGGCGAC AATTTTGAAG CATTGGACGC TGTAGATAGA TGTAATAACT CTCTAGATAT
GTGGTTCCAA TTCATTCTTA TTGATCGATG TTATTGTATT GTTCATGTTC TCCACCGCTG AGAAAAATTA ATCAGTGATG
GTTGATCCGG TCTCTTGCCA TTGTAAGTTG TAAGCAAGAA GGCCCTCTTC TTAGTATCCA TGCTGATGAA CGAAATTAAA
ACCTTCATTT TTCGTGT