Os02t0661100-02

Locus

Os02g0661100

Description

Similar to Trehalose-phosphate phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TPP1

CGSNL Gene Name

TREHALOSE-6-PHOSPHATE PHOSHPHATASE 1

Oryzabase Gene Symbol Synonym(s)

OsTPP1, OsTPS

Oryzabase Gene Name Synonym(s)

Trehalose-6-phosphate phosphatase 1, trehalose 6-P synthase

Transcript Evidence

AK059390 (DDBJ, Best hit)

Protein Evidence

Q3ZTF5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: trehalose biosynthetic process (GO:0005992)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Trehalose-phosphatase (IPR003337)

HAD-superfamily hydrolase, subfamily IIB (IPR006379)

HAD-like domain (IPR023214)

Full-length cDNA

001-026-H06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0661100-02)

RiceXPro (AK059390)

Others

Oryzabase (6270)

KEGG (Os02t0661100-02)

Transcript

1334 bp

>Os02t0661100-02 Similar to Trehalose-phosphate phosphatase.
CTGATGCAGTTTTCAGTCATGCCCGGTGGCTACTCCAGCTCTGGCATGAACGTTGGTGTC
AGTAGGCTCAAAATCGAGGAAGTCCTTGTCAATGGACTGCTTGATGCCATGAAATCCTCG
TCACCTCGCAGGAGGCTGAATGTAGCATTTGGCGAGGACAATTCATCTGAAGAAGAAGAC
CCTGCTTACAGCGCTTGGATGGCAAAATGTCCTTCTGCTTTGGCTTCCTTCAAGCAAATT
GTAGCCAGTGCACAAGGGAAGAAGATTGCTGTGTTTCTAGACTATGACGGCACACTGTCG
CCTATTGTGGATGATCCTGACAAAGCAGTGATGTCTCCCGTGATGAGAGCTGCTGTGAGA
AATGTTGCGAAGTACTTCCCCACTGCAATTGTCAGCGGAAGGTCCCGCAATAAGGTGTTT
GAATTTGTAAAACTGAAGGAGCTTTATTATGCTGGAAGCCATGGTATGGACATAATGGCA
CCTTCAGCAAATCATGAGCACAGTGCTGAAAAGAGCAAACAGGCCAATCTCTTCCAACCT
GCACACGACTTTCTGCCAATGATCGATGAGGTTACCAAGTCCCTCTTGCAAGTTGTCAGT
GGAATTGAAGGTGCAACTGTTGAGAACAACAAATTCTGCGTTTCTGTACATTATCGCAAC
GTTGCAGAGAAGGATTGGAAACTGGTCGCACGGCTCGTAAACGAAGTGCTGGAGGCTTTT
CCTCGTCTCAAAGTAACCAATGGACGAATGGTTTTAGAGGTTCGTCCGGTGATCGACTGG
GACAAGGGAAAGGCTGTGGAGTTTCTGCTCCAGTCACTCGGGCTAAATGACTCTGAAAAT
GTGATCCCCATCTACATTGGAGACGACAGAACTGACGAAGACGCTTTCAAGGTACTTCGA
CAGCGAAATTGCGGTTATGGAATACTAGTTTCACAGGTTCCCAAGGAAACTGAAGCCTTC
TACTCGCTGAGAGATCCATCTGAAGTGATGGAGTTCCTCAATTTCTTGGTGAGATGGAAG
AAGCACTCAGTGTGAAAAAAAGAAGACAGTCTGAGCAGGTTTTACTAATACTACTCCGGC
AGAAATAACTGTAGTTTCCGAGGCGACAATTTTGAAGCATTGGACGCTGTAGATAGATGT
AATAACTCTCTAGATATGTGGTTCCAATTCATTCTTATTGATCGATGTTATTGTATTGTT
CATGTTCTCCACCGCTGAGAAAAATTAATCAGTGATGGTTGATCCGGTCTCTTGCCATTG
TAAGTTGTAAGCAAGAAGGCCCTCTTCTTAGTATCCATGCTGATGAACGAAATTAAAACC
TTCATTTTTCGTGT

CDS

1032 bp

>Os02t0661100-02 Similar to Trehalose-phosphate phosphatase.
ATGCAGTTTTCAGTCATGCCCGGTGGCTACTCCAGCTCTGGCATGAACGTTGGTGTCAGT
AGGCTCAAAATCGAGGAAGTCCTTGTCAATGGACTGCTTGATGCCATGAAATCCTCGTCA
CCTCGCAGGAGGCTGAATGTAGCATTTGGCGAGGACAATTCATCTGAAGAAGAAGACCCT
GCTTACAGCGCTTGGATGGCAAAATGTCCTTCTGCTTTGGCTTCCTTCAAGCAAATTGTA
GCCAGTGCACAAGGGAAGAAGATTGCTGTGTTTCTAGACTATGACGGCACACTGTCGCCT
ATTGTGGATGATCCTGACAAAGCAGTGATGTCTCCCGTGATGAGAGCTGCTGTGAGAAAT
GTTGCGAAGTACTTCCCCACTGCAATTGTCAGCGGAAGGTCCCGCAATAAGGTGTTTGAA
TTTGTAAAACTGAAGGAGCTTTATTATGCTGGAAGCCATGGTATGGACATAATGGCACCT
TCAGCAAATCATGAGCACAGTGCTGAAAAGAGCAAACAGGCCAATCTCTTCCAACCTGCA
CACGACTTTCTGCCAATGATCGATGAGGTTACCAAGTCCCTCTTGCAAGTTGTCAGTGGA
ATTGAAGGTGCAACTGTTGAGAACAACAAATTCTGCGTTTCTGTACATTATCGCAACGTT
GCAGAGAAGGATTGGAAACTGGTCGCACGGCTCGTAAACGAAGTGCTGGAGGCTTTTCCT
CGTCTCAAAGTAACCAATGGACGAATGGTTTTAGAGGTTCGTCCGGTGATCGACTGGGAC
AAGGGAAAGGCTGTGGAGTTTCTGCTCCAGTCACTCGGGCTAAATGACTCTGAAAATGTG
ATCCCCATCTACATTGGAGACGACAGAACTGACGAAGACGCTTTCAAGGTACTTCGACAG
CGAAATTGCGGTTATGGAATACTAGTTTCACAGGTTCCCAAGGAAACTGAAGCCTTCTAC
TCGCTGAGAGATCCATCTGAAGTGATGGAGTTCCTCAATTTCTTGGTGAGATGGAAGAAG
CACTCAGTGTGA

Protein

344 aa

>Os02t0661100-02 Similar to Trehalose-phosphate phosphatase.
MQFSVMPGGYSSSGMNVGVSRLKIEEVLVNGLLDAMKSSSPRRRLNVAFGEDNSSEEEDP
AYSAWMAKCPSALASFKQIVASAQGKKIAVFLDYDGTLSPIVDDPDKAVMSPVMRAAVRN
VAKYFPTAIVSGRSRNKVFEFVKLKELYYAGSHGMDIMAPSANHEHSAEKSKQANLFQPA
HDFLPMIDEVTKSLLQVVSGIEGATVENNKFCVSVHYRNVAEKDWKLVARLVNEVLEAFP
RLKVTNGRMVLEVRPVIDWDKGKAVEFLLQSLGLNDSENVIPIYIGDDRTDEDAFKVLRQ
RNCGYGILVSQVPKETEAFYSLRDPSEVMEFLNFLVRWKKHSV*

5'UTR

chr02:26769927..26769929 (- strand) : 3 bp

CDS

chr02:26769729..26769926 (- strand) : 198 bp

chr02:26769471..26769611 (- strand) : 141 bp

chr02:26769311..26769382 (- strand) : 72 bp

chr02:26769102..26769200 (- strand) : 99 bp

chr02:26768927..26768983 (- strand) : 57 bp

chr02:26768653..26768754 (- strand) : 102 bp

chr02:26768480..26768557 (- strand) : 78 bp

chr02:26768228..26768368 (- strand) : 141 bp

chr02:26768040..26768132 (- strand) : 93 bp

chr02:26767906..26767956 (- strand) : 51 bp

3'UTR

chr02:26767607..26767905 (- strand) : 299 bp

FASTA

>Os02t0661100-02 class=Sequence position=chr02:26767607..26769929 (- strand)
CTGATGCAGT TTTCAGTCAT GCCCGGTGGC TACTCCAGCT CTGGCATGAA CGTTGGTGTC AGTAGGCTCA AAATCGAGGA
AGTCCTTGTC AATGGACTGC TTGATGCCAT GAAATCCTCG TCACCTCGCA GGAGGCTGAA TGTAGCATTT GGCGAGGACA
ATTCATCTGA AGAAGAAGAC CCTGCTTACA GCGCTTGGAT GGTAAGCTAC AATGGTTACA TTGGTTGTGT TTCTGTTGGC
CTAATAAGTT GTACTAGTAA CTCGCAATCC TTTTCTTTTC GTGGACAGTA CTGACATATG TGATGACTTG TGTTGCAGGC
AAAATGTCCT TCTGCTTTGG CTTCCTTCAA GCAAATTGTA GCCAGTGCAC AAGGGAAGAA GATTGCTGTG TTTCTAGACT
ATGACGGCAC ACTGTCGCCT ATTGTGGATG ATCCTGACAA AGCAGTGATG TCTCCCGTGG TAAGTCTGAA TATAAACTCT
GACCAATAAC TAGCATTTCT TGGTTAATGA AGAGCTGCTT TGAATTAAAT TAAAAACTTT TCCTCAGATG AGAGCTGCTG
TGAGAAATGT TGCGAAGTAC TTCCCCACTG CAATTGTCAG CGGAAGGTCC CGCAATAAGG TACCGAAAAT ATGGTTGCAT
GCATTTTAGT GTACTAGTAT TAGAAGCCAA GTGATTGCAT ATGCAAGTGT ATGTCTTATC TTACATATGG CTTACTTATC
TCTATGCAGG TGTTTGAATT TGTAAAACTG AAGGAGCTTT ATTATGCTGG AAGCCATGGT ATGGACATAA TGGCACCTTC
AGCAAATCAT GAGCACAGTG CTGAAAAGGT GAGGATTTCT TGCCTATGTT TCTACAAATA GAGTGAAAAA GTCTACCTTT
TTTGGGGGCA TTCTAACAAA TATGTTCTAG TGTAAAATAC TGACTATGGC TTAATTCCAA CTACAGAGCA AACAGGCCAA
TCTCTTCCAA CCTGCACACG ACTTTCTGCC AATGATCGAT GAGGTGCATT TCTCTTTCAA CTTTGAAGTA AAAAAGTTGT
ATTGCTCTAT CCAGTTTAAC GCAAATATAA AACGATTCCA TCATCTCATT ATTATTCATA TAAATTACTG TGATTAGTCC
TGATGGGTGT GCAAAAGTTT TGTGCTATTT GTTAACAAAC TTTTTATTTC AACAGGTTAC CAAGTCCCTC TTGCAAGTTG
TCAGTGGAAT TGAAGGTGCA ACTGTTGAGA ACAACAAATT CTGCGTTTCT GTACATTATC GCAACGTTGC AGAGAAGGTA
AAAACTGTTT TTTTTTCCGT CATACTTTTT TCTCTGCTCC CAAGCGCTTG GAAAATGAAA ATTCATCTGA CAATATTGCT
TCTTGTTTGC AGGATTGGAA ACTGGTCGCA CGGCTCGTAA ACGAAGTGCT GGAGGCTTTT CCTCGTCTCA AAGTAACCAA
TGGACGAATG GTAAGAACGC TATGCCAAGT CTATTTAGCT GTACACTGAA ACTTACCCAT TTCCTGGTAA TTTGCACATC
TATCAAACCC TGTGCTGAAT ATTCTGGAAA TATATCTTCA GGTTTTAGAG GTTCGTCCGG TGATCGACTG GGACAAGGGA
AAGGCTGTGG AGTTTCTGCT CCAGTCACTC GGGCTAAATG ACTCTGAAAA TGTGATCCCC ATCTACATTG GAGACGACAG
AACTGACGAA GACGCTTTCA AGGTTCATAT ATTTTCTGGA GAACACGTAG TGCTGTATAT CCTAGTCGCA TCTTTGATTC
AGTGTAAACT GATATAGCGG TCATTTGGTT TAACCAGGTA CTTCGACAGC GAAATTGCGG TTATGGAATA CTAGTTTCAC
AGGTTCCCAA GGAAACTGAA GCCTTCTACT CGCTGAGAGA TCCATCTGAA GTAAGCTCAA AAGAATATCT TTCTTCTTCC
TTGGGTGATT TTCATTCGAC GTGTTCATCA TTAACTGTTT GCTTATCGTA CAGGTGATGG AGTTCCTCAA TTTCTTGGTG
AGATGGAAGA AGCACTCAGT GTGAAAAAAA GAAGACAGTC TGAGCAGGTT TTACTAATAC TACTCCGGCA GAAATAACTG
TAGTTTCCGA GGCGACAATT TTGAAGCATT GGACGCTGTA GATAGATGTA ATAACTCTCT AGATATGTGG TTCCAATTCA
TTCTTATTGA TCGATGTTAT TGTATTGTTC ATGTTCTCCA CCGCTGAGAA AAATTAATCA GTGATGGTTG ATCCGGTCTC
TTGCCATTGT AAGTTGTAAG CAAGAAGGCC CTCTTCTTAG TATCCATGCT GATGAACGAA ATTAAAACCT TCATTTTTCG
TGT